Overview

  • Product name

  • Description

    Rabbit polyclonal to PEX5/PER3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PEX5/PER3 aa 1-639.
    Sequence:

    MAMRELVEAECGGANPLMKLAGHFTQDKALRQEGLRPGPWPPGAPASEAA SKPLGVASEDELVAEFLQDQNAPLVSRAPQTFKMDDLLAEMQQIEQSNFR QAPQRAPGVADLALSENWAQEFLAAGDAVDVTQDYNETDWSQEFISEVTD PLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASD FVAKVDDPKLANSEFLKFVRQIGEGQVSLESGAGSGRAQAEQWAAEFIQQ QGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEMAK RDAEAHPWLSDYDDLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGD LPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKP DNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGA GLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNL SGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALE LQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMS ENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ


    Database link: P50542

  • General notes

     This product was previously labelled as PEX5

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    The purity of ab192322 is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 71 kDa.

Target

  • Function

    Binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import.
  • Tissue specificity

    Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Involvement in disease

    Defects in PEX5 are a cause of adrenoleukodystrophy neonatal (NALD) [MIM:202370]. NALD is a peroxisome biogenesis disorder (PBD) characterized by the accumulation of very long-chain fatty acids, adrenal insufficiency and mental retardation. Inheritance is autosomal recessive.
    Defects in PEX5 are a cause of Zellweger syndrome (ZWS) [MIM:214100]. ZWS is a fatal peroxisome biogenesis disorder characterized by dysmorphic facial features, hepatomegaly, ocular abnormalities, renal cysts, hearing impairment, profound psychomotor retardation, severe hypotonia and neonatal seizures. Death occurs within the first year of life.
    Defects in PEX5 may be a cause of infantile Refsum disease (IRD) [MIM:266510]. IRD is a mild peroxisome biogenesis disorder (PBD). Clinical features include early onset, mental retardation, minor facial dysmorphism, retinopathy, sensorineural hearing deficit, hepatomegaly, osteoporosis, failure to thrive, and hypocholesterolemia. The biochemical abnormalities include accumulation of phytanic acid, very long chain fatty acids (VLCFA), di- and trihydroxycholestanoic acid and pipecolic acid.
  • Sequence similarities

    Belongs to the peroxisomal targeting signal receptor family.
    Contains 7 TPR repeats.
  • Cellular localization

    Cytoplasm. Peroxisome membrane. Its distribution appears to be dynamic. It is probably a cycling receptor found mainly in the cytoplasm and as well associated to the peroxisomal membrane through a docking factor.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ50634 antibody
    • FLJ50721 antibody
    • FLJ51948 antibody
    • PBD2A antibody
    • PBD2B antibody
    • Peroxin 5 antibody
    • Peroxin-5 antibody
    • Peroxisomal biogenesis factor 5 antibody
    • Peroxisomal C terminal targeting signal import receptor antibody
    • Peroxisomal C-terminal targeting signal import receptor antibody
    • Peroxisomal targeting signal 1 (SKL type) receptor antibody
    • Peroxisomal targeting signal 1 receptor antibody
    • Peroxisomal targeting signal import receptor antibody
    • Peroxisomal targeting signal receptor 1 antibody
    • Peroxisome receptor 1 antibody
    • pex5 antibody
    • PEX5_HUMAN antibody
    • PTS1 BP antibody
    • PTS1 receptor antibody
    • PTS1-BP antibody
    • PTS1R antibody
    • PXR1 antibody
    see all

References

This product has been referenced in:

  • Lyman KA  et al. Allostery between two binding sites in the ion channel subunit TRIP8b confers binding specificity to HCN channels. J Biol Chem 292:17718-17730 (2017). Read more (PubMed: 28887304) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up