Overview

  • Product name

    Anti-PEX6 antibody [N233/8] (Biotin)
    See all PEX6 primary antibodies
  • Description

    Mouse monoclonal [N233/8] to PEX6 (Biotin)
  • Host species

    Mouse
  • Conjugation

    Biotin
  • Specificity

    <50% identity with other PEX proteins.
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human PEX6 aa 2-294 (N terminal). NP_000278.3.
    Sequence:

    ALAVLRVLEPFPTETPPLAVLLPPGGPWPAAELGLVLALRPAGESPAGPA LLVAALEGPDAGTEEQGPGPPQLLVSRALLRLLALGSGAWVRARAVRRPP ALGWALLGTSLGPGLGPRVGPLLVRRGETLPVPGPRVLETRPALQGLLGP GTRLAVTELRGRARLCPESGDSSRPPPPPVVSSFAVSGTVRRLQGVLGGT GDSLGVSRSCLRGLGLFQGEWVWVAQARESSNTSQPHLARVQVLEPRWDL SDRLGPGSGPLGEPLADGLALVPATLAFNLGCDPLEMGELRIQ


    Database link: Q13608

  • Positive control

    • Rat brain lysate.
  • General notes

    The clone number has been updated from S233-8 to N233/8, both clone numbers name the same antibody clone.

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    pH: 7.40
    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    N233/8
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/1000. Predicted molecular weight: 104 kDa.

Target

  • Relevance

    This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) family of ATPases. This member is a predominantly cytoplasmic protein, which plays a direct role in peroxisomal protein import and is required for PTS1 (peroxisomal targeting signal 1, a C-terminal tripeptide of the sequence ser-lys-leu) receptor activity. Mutations in this gene cause peroxisome biogenesis disorders of complementation group 4 and complementation group 6.
  • Cellular localization

    Cytoplasm. Peroxisome membrane. Note: Associated with peroxisomal membranes.
  • Database links

  • Alternative names

    • PAF 2 antibody
    • PAF2 antibody
    • PBD4A antibody
    • PDB4B antibody
    • Peroxin 6 antibody
    • Peroxisomal AAA type ATPase 1 antibody
    • Peroxisomal biogenesis factor 6 antibody
    • Peroxisomal type ATPase 1 antibody
    • Peroxisome assembly factor 2 antibody
    • PXAAA1 antibody
    see all

References

ab186302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up