Anti-Pf1 antibody (ab219863)
Key features and details
- Rabbit polyclonal to Pf1
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Pf1 antibody
See all Pf1 primary antibodies -
Description
Rabbit polyclonal to Pf1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human Pf1 aa 239-332.
Sequence:GSSKRRRKEETTGKNVKKTQHELDHNGLVPLPVKVCFTCNRSCRVAPLIQ CDYCPLLFHMDCLEPPLTAMPLGRWMCPNHIEHVVLNQKNMTLS
Database link: Q96QT6 -
Positive control
- A549 cells.
-
General notes
Previously labelled as PHF12.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab219863 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Relevance
Pf1 acts as a transcriptional repressor. It is involved in recruitment of functional SIN3A complexes to DNA. Pf1 represses transcription at least in part through the activity of an associated histone deacetylase (HDAC). It may also repress transcription in a SIN3A-independent manner through recruitment of functional AES complexes to DNA. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 57649 Human
- Entrez Gene: 268448 Mouse
- Entrez Gene: 303274 Rat
- SwissProt: Q96QT6 Human
-
Alternative names
- FLJ34122 antibody
- KIAA1523 antibody
- MGC131914 antibody
see all
Images
Protocols
Datasheets and documents
References (0)
ab219863 has not yet been referenced specifically in any publications.