Overview

  • Product name

    Anti-PFDN2 antibody - C-terminal
    See all PFDN2 primary antibodies
  • Description

    Rabbit polyclonal to PFDN2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human PFDN2 aa 104-154 (C terminal). The exact sequence is proprietary.
    Sequence:

    LTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLV S


    Database link: Q9UHV9

  • Positive control

    • HeLa, 293T, Jurkat, TCMK1 and NIH 3T3 whole cell lysates.

Properties

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab206691 was affinity purified using an epitope specific to PFDN2 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab206691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 17 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-PFDN2 antibody - C-terminal (ab206691) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 17 kDa


    Exposure time: 10 seconds


    4-12% Bis-Tris gel

  • Detection of PFDN2 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab206691 at 6 µg/mg lysate for IP and 0.4µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab206691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Liver)
Antigen retrieval step
Other
Permeabilization
No
Specification
Liver
Blocking step
Step1: 3% H2O2 / Step2: Proteinblock 1 from ZytoChem-Plus HRP Polymer Kit as a blocking agent for 5 Min as blocking agent for 5 minute(s) · Concentration: 0% · Temperature: 20°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Feb 28 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up