Anti-PFDN5 antibody (ab174647)
Key features and details
- Rabbit polyclonal to PFDN5
- Suitable for: WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-PFDN5 antibody
See all PFDN5 primary antibodies -
Description
Rabbit polyclonal to PFDN5 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rabbit, Cow, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
-
Immunogen
Synthetic peptide within Human PFDN5 aa 1-50. The exact sequence is proprietary.
Sequence:MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCL
Database link: Q99471 -
Positive control
- Jurkat, 293T, HeLa, TCMK-1 and NIH3T3 whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab174647 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/2500. Predicted molecular weight: 17 kDa. |
Target
-
Function
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. -
Tissue specificity
Highly expressed in pancreas and skeletal muscle and moderately in other tissues. -
Sequence similarities
Belongs to the prefoldin subunit alpha family. - Information by UniProt
-
Database links
- Entrez Gene: 282848 Cow
- Entrez Gene: 5204 Human
- Entrez Gene: 56612 Mouse
- Entrez Gene: 100172545 Orangutan
- Omim: 604899 Human
- SwissProt: Q8HYI9 Cow
- SwissProt: Q99471 Human
- SwissProt: Q9WU28 Mouse
see all -
Alternative names
- 1190001O17Rik antibody
- 1700010A06Rik antibody
- c myc binding protein antibody
see all
Images
-
Western blot - Anti-PFDN5 antibody (ab174647)All lanes : Anti-PFDN5 antibody (ab174647) at 1 µg/ml
Lane 1 : Jurkat whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : HeLa whole cell lysate
Lane 4 : TCMK-1 whole cell lysate
Lane 5 : NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 17 kDa
Exposure time: 3 minutes
Datasheets and documents
References (0)
ab174647 has not yet been referenced specifically in any publications.
