Anti-PFDN5 antibody (ab174647)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PFDN5 antibody
See all PFDN5 primary antibodies -
Description
Rabbit polyclonal to PFDN5 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details
Unsuitable for: IP -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rabbit, Cow, Chimpanzee, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human PFDN5 aa 1-50. The exact sequence is proprietary.
Sequence:MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCL
Database link: Q99471 -
Positive control
- Jurkat, 293T, HeLa, TCMK-1 and NIH3T3 whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab174647 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2500. Predicted molecular weight: 17 kDa. |
Target
-
Function
Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. -
Tissue specificity
Highly expressed in pancreas and skeletal muscle and moderately in other tissues. -
Sequence similarities
Belongs to the prefoldin subunit alpha family. - Information by UniProt
-
Database links
- Entrez Gene: 282848 Cow
- Entrez Gene: 5204 Human
- Entrez Gene: 56612 Mouse
- Entrez Gene: 100172545 Orangutan
- Omim: 604899 Human
- SwissProt: Q8HYI9 Cow
- SwissProt: Q99471 Human
- SwissProt: Q9WU28 Mouse
see all -
Alternative names
- 1190001O17Rik antibody
- 1700010A06Rik antibody
- c myc binding protein antibody
see all
Images
-
All lanes : Anti-PFDN5 antibody (ab174647) at 1 µg/ml
Lane 1 : Jurkat whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : HeLa whole cell lysate
Lane 4 : TCMK-1 whole cell lysate
Lane 5 : NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 17 kDa
Exposure time: 3 minutes
Protocols
Datasheets and documents
References
ab174647 has not yet been referenced specifically in any publications.