Overview

  • Product name
  • Description
    Rabbit polyclonal to PFDN5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Cow, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human PFDN5 aa 1-50. The exact sequence is proprietary.
    Sequence:

    MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCL


    Database link: Q99471

  • Positive control
    • Jurkat, 293T, HeLa, TCMK-1 and NIH3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab174647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 17 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function
      Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
    • Tissue specificity
      Highly expressed in pancreas and skeletal muscle and moderately in other tissues.
    • Sequence similarities
      Belongs to the prefoldin subunit alpha family.
    • Information by UniProt
    • Database links
    • Alternative names
      • 1190001O17Rik antibody
      • 1700010A06Rik antibody
      • c myc binding protein antibody
      • c-myc binding protein MM 1 antibody
      • C-myc-binding protein Mm-1 antibody
      • D15Ertd697e antibody
      • EIG 1 antibody
      • Eig1 antibody
      • MGC5329 antibody
      • MGC71907 antibody
      • MM 1 antibody
      • MM1 antibody
      • Myc modulator 1 antibody
      • PFD5 antibody
      • PFD5_HUMAN antibody
      • PFDN5 antibody
      • Prefoldin 5 antibody
      • Prefoldin subunit 5 antibody
      see all

    Images

    • All lanes : Anti-PFDN5 antibody (ab174647) at 1 µg/ml

      Lane 1 : Jurkat whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : HeLa whole cell lysate
      Lane 4 : TCMK-1 whole cell lysate
      Lane 5 : NIH3T3 whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 17 kDa


      Exposure time: 3 minutes

    References

    ab174647 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab174647.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up