Overview

  • Product name

  • Description

    Rabbit polyclonal to PFKFB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PFKFB2 aa 360-505.
    Sequence:

    YPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADE LPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTP VRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD


    Database link: O60825

  • Positive control

    • WB: K562 whole cell lysate; Rat brain and kidney lysates. IHC-P: Human lung cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/5000. Predicted molecular weight: 58 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-PFKFB2 antibody (ab234865) at 1/200 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate
    Lane 2 : Rat kidney lysate
    Lane 3 : Rat brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 58 kDa

  • Paraffin-embedded human lung cancer tissue stained for PFKFB2 using ab234865 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for PFKFB2 (green) using ab234865 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up