Overview

  • Product name

  • Description

    Rabbit polyclonal to PFKP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Rabbit, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human PFKP aa 553-753. Expressed in E.coli.
    Sequence:

    DTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADA AYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQ LYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLK EARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWL K


    Database link: Q01813

  • Positive control

    • WB: Recombinant human PFKP protein; A549 and Jurkat whole cell lysate (ab7899); Pig heart and skeletal muscle lysates. IHC-P: Human lung cancer, liver, brain, breast cancer, prostate cancer and stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 86 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-PFKP antibody (ab233109) at 5 µg/ml + Recombinant human PFKP protein

    Predicted band size: 86 kDa

  • All lanes : Anti-PFKP antibody (ab233109) at 3 µg/ml

    Lane 1 : A549 (human lung carcinoma cell line) cell lysate
    Lane 2 : Pig heart lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 4 : Pig skeletal muscle lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 86 kDa

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for PFKP using ab233109 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PFKP using ab233109 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human brain tissue stained for PFKP using ab233109 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for PFKP using ab233109 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for PFKP using ab233109 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for PFKP using ab233109 at 10 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up