Overview

  • Product name

    Anti-PFTK1 antibody
  • Description

    Rabbit polyclonal to PFTK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rabbit, Common marmoset, Xenopus tropicalis, Nine-banded armadillo, Titi
  • Immunogen

    Recombinant fragment corresponding to Human PFTK1 aa 35-158.
    Sequence:

    DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFE KPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADS YEKLEKLGEGSYATVYKGKSKVNG


    Database link: O94921

  • Positive control

    • IHC-P: Human cerebral cortex tissue. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100.

Target

  • Function

    Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by mediating the phosphorylation of LRP6 at 'Ser-1490', leading to the activation of the Wnt signaling pathway. Acts as a regulator of cell cycle progression and cell proliferation via its interaction with CCDN3. Phosphorylates RB1 in vitro, however the relevance of such result remains to be confirmed in vivo. May also play a role in meiosis, neuron differentiation and may indirectly act as a negative regulator of insulin-responsive glucose transport.
  • Tissue specificity

    Highly expressed in brain, pancreas, kidney, heart, testis and ovary. Also detected at lower levels in other tissues except in spleen and thymus where expression is barely detected.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cell membrane. Cytoplasm. Nucleus. Recruited to the cell membrane by CCNY.
  • Information by UniProt
  • Database links

  • Alternative names

    • cdk14 antibody
    • CDK14_HUMAN antibody
    • Cell division protein kinase 14 antibody
    • Cyclin-dependent kinase 14 antibody
    • hPFTAIRE1 antibody
    • KIAA0834 antibody
    • mKIAA0834 antibody
    • PFTAIRE protein kinase 1 antibody
    • PFTAIRE1 antibody
    • PFTK1 antibody
    • Serine/threonine protein kinase PFTAIRE 1 antibody
    • Serine/threonine-protein kinase PFTAIRE-1 antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for PFTK1 using ab224098 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PFTK1 (green) using ab224098 at 4 µg/ml in ICC/IF.

References

This product has been referenced in:

  • Li SM  et al. The putative tumour suppressor miR-1-3p modulates prostate cancer cell aggressiveness by repressing E2F5 and PFTK1. J Exp Clin Cancer Res 37:219 (2018). Read more (PubMed: 30185212) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up