Overview

  • Product name

    Anti-PGA5 antibody [C4]
    See all PGA5 primary antibodies
  • Description

    Mouse monoclonal [C4] to PGA5
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human PGA5 aa 63-295. Expressed in E.coli.
    Sequence:

    VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLAC TNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQI FGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDL FSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMN GETIACAEGCQAIVDTGTSLLTGPTSPIANIQS


    Database link: P0DJD9

  • Positive control

    • WB: Recombinant human PGA5 protein; Pig stomach lysate. IHC-P: Human stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C4
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 42 kDa.

Target

Images

  • Anti-PGA5 antibody [C4] (ab239479) at 5 µg/ml + Recombinant human PGA5 protein

    Predicted band size: 42 kDa

  • Anti-PGA5 antibody [C4] (ab239479) at 5 µg/ml + Pig stomach lysate

    Predicted band size: 42 kDa

  • Paraffin-embedded human stomach tissue stained for PGA5 using ab239479 at 30 μg/ml in immunohistochemical analysis. DAB staining.

References

ab239479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up