Anti-PGAM5 antibody (ab126534)
Key features and details
- Rabbit polyclonal to PGAM5
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PGAM5 antibody
See all PGAM5 primary antibodies -
Description
Rabbit polyclonal to PGAM5 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PGAM5 aa 61-146.
Sequence:NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHV DGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Database link: Q96HS1 -
Positive control
- ICC: MCF-7 whole cells; WB: RT-4 whole cell lysates transfected with siRNA; IHC-P: Human liver, testis, tonsil and colon tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab126534 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
|
WB | (2) |
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 32 kDa.
|
IHC-P |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
WB
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 32 kDa. |
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5 kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate for a KEAP1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression. -
Sequence similarities
Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily. -
Domain
According to PubMed:18387606, may contain a non-cleaved N-terminal mitochondrial targeting sequence that targets PGAM5 to the cytosolic side of the outer mitochondrial membrane, instead of a N-terminal transmembrane. -
Cellular localization
Mitochondrion. Mitochondrion outer membrane. Membrane. Isoform 2 overexpression results in the formation of disconnected punctuate mitochondria distributed throughout the cytoplasm. Isoform 1 overexpression results in the clustering of mitochondria around the nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 192111 Human
- SwissProt: Q96HS1 Human
- Unigene: 102558 Human
-
Alternative names
- Bcl-XL-binding protein v68 antibody
- BXLBv68 antibody
- MGC5352 antibody
see all
Images
-
All lanes : Anti-PGAM5 antibody (ab126534) at 0.4 µg/ml
Lane 1 : Control siRNA transfected into RT4 (Human urinary bladder cancer cell line) whole cell lysate
Lane 2 : siRNA probe #1 transfected into RT4 whole cell lysate
Lane 3 : siRNA probe #2 transfected into RT4 whole cell lysate
Predicted band size: 32 kDaLoading control: Anti-PPIB
Genetic validation in WB by siRNA knockdown.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
Immunohistochemical analysis of human colon tissue labeling PGAM5 in the granular cytoplasm of glandular cells with ab126534 at a 1/200 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunocytochemical analysis of MCF7 (Human breast adenocarcinoma cell line) whole cells labeling PGAM5 in the mitochondria with ab126534 2 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
Immunohistochemical analysis of human liver tissue labeling PGAM5 in the granular cytoplasm of hepatocytes with ab126534 at a 1/200 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
Immunohistochemical analysis of human tonsil tissue labeling PGAM5 in the granular cytoplasm of germinal center cells with ab126534 at a 1/200 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
Immunohistochemical analysis of human testis tissue labeling PGAM5 in the granular cytoplasm of cells in seminiferous ducts with ab126534 at a 1/200 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (20)
ab126534 has been referenced in 20 publications.
- Ju J et al. D-allose alleviates ischemia/reperfusion (I/R) injury in skin flap via MKP-1. Mol Med 26:21 (2020). PubMed: 32046628
- Hoshino A et al. The ADP/ATP translocase drives mitophagy independent of nucleotide exchange. Nature 575:375-379 (2019). PubMed: 31618756
- Gu X et al. P16INK4a played a critical role in exacerbating acute tubular necrosis in acute kidney injury. Am J Transl Res 11:3850-3861 (2019). PubMed: 31312394
- Cloer EW et al. p62-Dependent Phase Separation of Patient-Derived KEAP1 Mutations and NRF2. Mol Cell Biol 38:N/A (2018). PubMed: 30126895
- Sugo M et al. Syntaxin 17 regulates the localization and function of PGAM5 in mitochondrial division and mitophagy. EMBO J 37:N/A (2018). PubMed: 30237312