For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    pgam5-antibody-ab126534.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Ser / Thr Phosphatases
Share by email

Anti-PGAM5 antibody (ab126534)

  • Datasheet
  • SDS
Reviews (2)Q&A (3)References (20)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-PGAM5 antibody (ab126534)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
  • Immunocytochemistry/ Immunofluorescence - Anti-PGAM5 antibody (ab126534)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

Key features and details

  • Rabbit polyclonal to PGAM5
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Knockout
Product image
Human PGAM5 knockout HeLa cell line (ab265141)

View more associated products

Overview

  • Product name

    Anti-PGAM5 antibody
    See all PGAM5 primary antibodies
  • Description

    Rabbit polyclonal to PGAM5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PGAM5 aa 61-146.
    Sequence:

    NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHV DGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV


    Database link: Q96HS1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • ICC: MCF-7 whole cells; WB: RT-4 whole cell lysates transfected with siRNA; IHC-P: Human liver, testis, tonsil and colon tissue.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Protein Phosphorylation
    • Ser / Thr Phosphatases

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab126534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF
Use a concentration of 0.25 - 2 µg/ml.
WB (2)
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 32 kDa.
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Notes
ICC/IF
Use a concentration of 0.25 - 2 µg/ml.
WB
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 32 kDa.
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5 kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate for a KEAP1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression.
  • Sequence similarities

    Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily.
  • Domain

    According to PubMed:18387606, may contain a non-cleaved N-terminal mitochondrial targeting sequence that targets PGAM5 to the cytosolic side of the outer mitochondrial membrane, instead of a N-terminal transmembrane.
  • Cellular localization

    Mitochondrion. Mitochondrion outer membrane. Membrane. Isoform 2 overexpression results in the formation of disconnected punctuate mitochondria distributed throughout the cytoplasm. Isoform 1 overexpression results in the clustering of mitochondria around the nucleus.
  • Target information above from: UniProt accession Q96HS1 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 192111 Human
    • SwissProt: Q96HS1 Human
    • Unigene: 102558 Human
    • Alternative names

      • Bcl-XL-binding protein v68 antibody
      • BXLBv68 antibody
      • MGC5352 antibody
      • mitochondrial antibody
      • PGAM5 antibody
      • PGAM5_HUMAN antibody
      • Phosphoglycerate mutase family member 5 antibody
      • Serine/threonine protein phosphatase PGAM5 mitochondrial antibody
      • Serine/threonine-protein phosphatase PGAM5 antibody
      see all

    Images

    • Western blot - Anti-PGAM5 antibody (ab126534)
      Western blot - Anti-PGAM5 antibody (ab126534)
      All lanes : Anti-PGAM5 antibody (ab126534) at 0.4 µg/ml

      Lane 1 : Control siRNA transfected into RT4 (Human urinary bladder cancer cell line) whole cell lysate
      Lane 2 : siRNA probe #1 transfected into RT4 whole cell lysate
      Lane 3 : siRNA probe #2 transfected into RT4 whole cell lysate

      Predicted band size: 32 kDa



      Loading control: Anti-PPIB

      Genetic validation in WB by siRNA knockdown.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

      Immunohistochemical analysis of human colon tissue labeling PGAM5 in the granular cytoplasm of glandular cells with ab126534 at a 1/200 dilution.

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunocytochemistry/ Immunofluorescence - Anti-PGAM5 antibody (ab126534)
      Immunocytochemistry/ Immunofluorescence - Anti-PGAM5 antibody (ab126534)

      Immunocytochemical analysis of MCF7 (Human breast adenocarcinoma cell line) whole cells labeling PGAM5 in the mitochondria with  ab126534 2 µg/ml. 

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

      Immunohistochemical analysis of human liver tissue labeling PGAM5 in the granular cytoplasm of hepatocytes with ab126534 at a 1/200 dilution.

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

      Immunohistochemical analysis of human tonsil tissue labeling PGAM5 in the granular cytoplasm of germinal center cells with ab126534 at a 1/200 dilution.

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGAM5 antibody (ab126534)

      Immunohistochemical analysis of human testis tissue labeling PGAM5 in the granular cytoplasm of cells in seminiferous ducts with ab126534 at a 1/200 dilution.

      Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (20)

    Publishing research using ab126534? Please let us know so that we can cite the reference in this datasheet.

    ab126534 has been referenced in 20 publications.

    • Ju J  et al. D-allose alleviates ischemia/reperfusion (I/R) injury in skin flap via MKP-1. Mol Med 26:21 (2020). PubMed: 32046628
    • Hoshino A  et al. The ADP/ATP translocase drives mitophagy independent of nucleotide exchange. Nature 575:375-379 (2019). PubMed: 31618756
    • Gu X  et al. P16INK4a played a critical role in exacerbating acute tubular necrosis in acute kidney injury. Am J Transl Res 11:3850-3861 (2019). PubMed: 31312394
    • Cloer EW  et al. p62-Dependent Phase Separation of Patient-Derived KEAP1 Mutations and NRF2. Mol Cell Biol 38:N/A (2018). PubMed: 30126895
    • Sugo M  et al. Syntaxin 17 regulates the localization and function of PGAM5 in mitochondrial division and mitophagy. EMBO J 37:N/A (2018). PubMed: 30237312
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-5 of 5 Abreviews or Q&A

    Western blot abreview for Anti-PGAM5 antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Mouse Tissue lysate - whole (thymus and spleen)
    Loading amount
    30 µg
    Specification
    thymus and spleen
    Gel Running Conditions
    Reduced Denaturing (10 Bis Tris)
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: rt°C
    Read More

    Abcam user community

    Verified customer

    Submitted Apr 18 2013

    Western blot abreview for Anti-PGAM5 antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Xenopus laevis Tissue lysate - whole (whole embryo)
    Loading amount
    15 µg
    Specification
    whole embryo
    Gel Running Conditions
    Reduced Denaturing (10%)
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More

    Abcam user community

    Verified customer

    Submitted Nov 27 2012

    Question

    Xenopus: ab67992 und ab126534

    Read More

    Abcam community

    Verified customer

    Asked on Nov 05 2012

    Answer

    ab67992 : DISCOUNT CODE: ABTRIAL-000

    ab126534 : DISCOUNT CODE: ABTRIAL-000

    Ablaufdatum: 05. März 2013

    Es freut mich zu hören, dass Sie unser Angebot unsere Antikörper ab67992 und ab126534 in Xenopus zu testen, annehmen möchten. Wie am Telefon besprochen, können Sie den Gutscheincodes zum Kauf eines weiteren Antikörpers einsetzen, sobald Sie uns ein Abreview für diesen Antikörper eingereicht haben. Die Discountcodes decken je den Wert von ab67992 oder ab126534 ab und können zum Kauf weiterer Produkte eingesetzt werden.

    Ein Code wird gültig, sobald Sie uns ein Abreview für diesen Antikörper über den Test in Xenopus eingereicht haben. Bitte geben Sie diesen Code auch im Abschnitt “Additional Notes” des Abreviews mit an, so dass wir wissen, dass sich dieses Abreview auf die Gutscheinaktion bezieht. Der Code wird dadurch aktiviert. Bitte kontaktieren Sie bei der nächsten Bestellung unsere Kundendienst mit dem Code.

    Bitte zögern Sie nicht, sich wieder an uns zu wenden, falls Sie weitere Fragen haben. Wir freuen uns auf Ihr Abreview, egal ob Ihre Ergebnisse positiv oder negativ sind und wünschen Ihnen viel Glück für Ihre Forschung.

    Die Bedingungen dieses Angebotes befinden sich unter dem folgenden Link: www.abcam.com/collaborationdiscount

    Read More

    Abcam Scientific Support

    Answered on Nov 05 2012

    Question


    Hola, Estoy interesado en usar el anticuerpo ab126534 con células procedentes de ratón. Sin embargo en vuestra datasheet solo figura Humano como especie testada. Como en la imagen del blot aparecen varias bandas inespecíficas, quisiera saber si podéis enviarme una muestra de prueba para testar el anticuerpo con nuestras muestras.
    Muchas gracias.

    Read More

    Abcam community

    Verified customer

    Asked on Oct 19 2012

    Answer

    Gracias por contactarnos.



    El anticuerpo ab126534 solo se ha testado en nuestro laboratorio en muestras humanas, lo cual no quiere decir que no vaya a reconocer la proteína en otras especies, pero al no tener datos para probarlo, no podemos garantizar su uso. Sin embargo, he llevado a cabo una alineación de secuencias entre el inmunógeno del anticuerpo y la proteína de ratón, y el porcentaje es muy elevado (94%):




    Sequence type explicitly set to Protein

    Sequence format is Pearson

    Sequence 1: IMMUNOGEN 86 aa

    Sequence 2: MOUSE 288 aa

    Start of Pairwise alignments

    Aligning...







    Sequences (1:2) Aligned. Score: 94.186

    Guide tree file created: http://www.genome.jp/tools-bin/pushfile?121019171842ErF4C+clustalw.dnd



    There are 1 groups

    Start of Multiple Alignment



    Aligning...

    Group 1: Sequences: 2 Score:1371

    Alignment Score 485



    CLUSTAL-Alignment file created http://www.genome.jp/tools-bin/pushfile?121019171842ErF4C+clustalw.aln






    http://www.genome.jp/tools-bin/pushfile?121019171842ErF4C+clustalw.aln

    CLUSTAL 2.1 multiple sequence alignment





    IMMUNOGEN -----------------------------------------------------------N

    MOUSE MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRGGGDADTRATEPPAWTGARAGRGVWDTN
    *



    IMMUNOGEN WDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLT

    MOUSE WDRREPLSLINLKKRNVESGEDELTSRLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLT
    ***********::********:**:*:*********************************



    IMMUNOGEN PLGREQAELTGLRLASLGLKFNKIV-----------------------------------

    MOUSE PLGREQAELTGLRLASLGLKFNKIVHSSMTRAVETTDIISKHLPGVSRVSTDLLREGAPI
    *************************



    IMMUNOGEN ------------------------------------------------------------

    MOUSE EPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRA




    IMMUNOGEN ------------------------------------------------

    MOUSE LQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS






    En Abcam ofrecemos un servicio de evaluación de anticuerpos, llamado Abreview, por el cual si compráis un anticuerpo y lo testáis en una nueva especie o aplicación y nos enviáis los resultados a la web (en forma de Abreview) os ofrecemos un descuento para la futura compra por el valor del anticuerpo testado (€399.00 en este caso).



    Si te interesa esta oferta, sigue los siguientes pasos:

    1. Contesta a este mail indicando que le gustaría probar en muestras de ratón. En ese momento se te enviará un código de descuento. Dicho código debe emitirse antes de la compra del producto en cuestión, así que te ruego que esperes a recibir una respuesta antes de hacer el pedido.

    2. Realiza la compra del anticuerpo bien sea por teléfono, fax, o a través de nuestra web (www.abcam.com)

    3. Pruébalo en la nueva especie a testar.

    4. A través del sistema Abreview, comparte tus resultados con nosotros, tanto si son positivos, como negativos (este proceso puede durar unos 10 minutos. Valoramos enormemente si pudieras adjuntar imágenes al Abreview!).

    5. Una vez hayamos publicado tu reseña, el código de descuento se activa. Simplemente realiza el nuevo pedido por teléfono, fax, o a través de la web, y no olvides mencionar el código de descuento. El descuento es válido durante 4 meses una vez emitido.

    Estamos muy agradecidos de recibir feedback de nuestros productos y cualquier información que puedas facilitarnos es bienvenida. Incluso si el producto resulta inadecuado para la especie testada, recibirás igualmente el descuento en tu próxima compra una vez que el Abreview haya sido publicado.

    Para conocer con más detalle nuestro sistema de Abreview, visita la página: https://www.abcam.com/abreview.

    No dudes en ponerte en contacto con nosotros si tienes cualquier otra consulta sobre esta oferta y estaré encantada de poder ayudarte.

    Las condiciones de uso de esta oferta puede usted consultarlas en https://www.abcam.com/collaborationdiscount.

    Read More

    Abcam Scientific Support

    Answered on Oct 19 2012

    Question

    Does this antibody recognize both isoforms of PGAM5 oris one of the bands around 32kDa non-specific?

    Read More

    Abcam community

    Verified customer

    Asked on Jul 30 2012

    Answer

    Thank you for contacting Abcam regarding ab126534.


    The Anti-PGAM5 antibody can recognize both the PGAM5-001 (ENSP00000321503) and PGAM5-005 (ENSP00000438465) isoforms, since the antigen sequence has 100% sequence identity to these two transcripts.

    The molecular weight of the two transcripts, 28 and 32 kDa, matches the two bands on the blot between the 28 and 36 kDa markers according to our QC criteria, so I have no reason to believe that either of the two bands should be unspecific.

    I hope this information is helpful. Please do not hesitate to contact me if you have any additional questions.

    Read More

    Abcam Scientific Support

    Answered on Jul 30 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.