Overview

  • Product name
  • Description
    Rabbit polyclonal to PGAM5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human PGAM5 aa 61-146.
    Sequence:

    NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHV DGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV


    Database link: Q96HS1

  • Positive control
    • ICC/IF: MCF-7 cells WB: RT-4 cell transfected with siRNA IHC-P: Human liver, testis, tonsil and colon tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab126534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

WB 1/500 - 1/1000. Predicted molecular weight: 32 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5 kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate for a KEAP1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression.
  • Sequence similarities
    Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily.
  • Domain
    According to PubMed:18387606, may contain a non-cleaved N-terminal mitochondrial targeting sequence that targets PGAM5 to the cytosolic side of the outer mitochondrial membrane, instead of a N-terminal transmembrane.
  • Cellular localization
    Mitochondrion. Mitochondrion outer membrane. Membrane. Isoform 2 overexpression results in the formation of disconnected punctuate mitochondria distributed throughout the cytoplasm. Isoform 1 overexpression results in the clustering of mitochondria around the nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Bcl-XL-binding protein v68 antibody
    • BXLBv68 antibody
    • MGC5352 antibody
    • mitochondrial antibody
    • PGAM5 antibody
    • PGAM5_HUMAN antibody
    • Phosphoglycerate mutase family member 5 antibody
    • Serine/threonine protein phosphatase PGAM5 mitochondrial antibody
    • Serine/threonine-protein phosphatase PGAM5 antibody
    see all

Images

  • Immunohistochemical analysis of human colon tissue labeling PGAM5 with ab126534 at 1/200 dilution.
  • Immunohistochemical analysis of human tonsil tissue labeling PGAM5 with ab126534 at 1/200 dilution.
  • Immunohistochemical analysis of human testis tissue labeling PGAM5 with ab126534 at 1/200 dilution.
  • Immunohistochemical analysis of human liver tissue labeling PGAM5 with ab126534 at 1/200 dilution.
  • All lanes : Anti-PGAM5 antibody (ab126534) at 0.4 µg/ml

    Lane 1 : RT-4 cell transfected with control siRNA, 100%
    Lane 2 : RT-4 cell transfected with siRNA Probe 1, 50%
    Lane 3 : RT-4 cell transfected with siRNA probe 2, 45%

    Predicted band size: 32 kDa



    Loading control: Anti-PPIB

    Genetic validation in WB by siRNA knockdown.

  • Immunofluorescent staining of Human cell line MCF-7 shows positivity in mitochondria. Recommended concentration of ab126534 1-4 µg/ml. Cells treated with PFA/Triton X-100.

References

This product has been referenced in:
  • Zhu P  et al. Ripk3 promotes ER stress-induced necroptosis in cardiac IR injury: A mechanism involving calcium overload/XO/ROS/mPTP pathway. Redox Biol 16:157-168 (2018). WB . Read more (PubMed: 29502045) »
  • Biswal S  et al. Salidroside mediated stabilization of Bcl -xL prevents mitophagy in CA3 hippocampal neurons during hypoxia. Neurobiol Dis 116:39-52 (2018). WB, IHC-Fr ; Rat . Read more (PubMed: 29723606) »
See all 15 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-2 of 2 Abreviews

Application
Western blot
Sample
Mouse Tissue lysate - whole (thymus and spleen)
Loading amount
30 µg
Specification
thymus and spleen
Gel Running Conditions
Reduced Denaturing (10 Bis Tris)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: rt°C

Abcam user community

Verified customer

Submitted Apr 18 2013

Application
Western blot
Sample
Xenopus laevis Tissue lysate - whole (whole embryo)
Loading amount
15 µg
Specification
whole embryo
Gel Running Conditions
Reduced Denaturing (10%)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Nov 27 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up