Overview

  • Product name

    Anti-PGE2 receptor EP4 subtype antibody (Phycoerythrin)
    See all PGE2 receptor EP4 subtype primary antibodies
  • Description

    Rabbit polyclonal to PGE2 receptor EP4 subtype (Phycoerythrin)
  • Host species

    Rabbit
  • Conjugation

    Phycoerythrin. Ex: 488nm, Em: 575nm
  • Tested applications

    Suitable for: Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Sheep, Human
    Predicted to work with: Rabbit, Chimpanzee, Baboon, Cynomolgus monkey
  • Immunogen

    Synthetic peptide corresponding to Human PGE2 receptor EP4 subtype aa 459-488 (C terminal).
    Sequence:

    GSGRAGPAPKGSSLQVTFPSETLNLSEKCI

  • Positive control

    • Jurkat Cells
  • General notes

    Visible absorption maxima 565>540>498. Emission maximum 578 nm.

     This product was previously labelled as Prostaglandin E Receptor EP4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab133716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/20.

ab37409 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
  • Tissue specificity

    High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EP 4 antibody
    • EP4 antibody
    • EP4R antibody
    • MGC126583 antibody
    • PE2R4_HUMAN antibody
    • PGE receptor EP4 subtype antibody
    • PGE2 receptor EP4 subtype antibody
    • Prostaglandin E receptor 4 antibody
    • Prostaglandin E receptor 4 subtype EP4 antibody
    • Prostaglandin E2 receptor antibody
    • Prostaglandin E2 receptor EP4 subtype antibody
    • Prostanoid EP4 receptor antibody
    • PTGER 2 antibody
    • PTGER 4 antibody
    • PTGER2 antibody
    • PTGER4 antibody
    see all

References

ab133716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up