SureLight® APC Anti-PGE2 receptor EP4 subtype antibody (ab92763)
Key features and details
- SureLight® APC Rabbit polyclonal to PGE2 receptor EP4 subtype
- Suitable for: ICC/IF
- Reacts with: Human
- Conjugation: SureLight® APC. Ex: 652nm, Em: 657nm
- Isotype: IgG
Overview
-
Product name
SureLight® APC Anti-PGE2 receptor EP4 subtype antibody
See all PGE2 receptor EP4 subtype primary antibodies -
Description
SureLight® APC Rabbit polyclonal to PGE2 receptor EP4 subtype -
Host species
Rabbit -
Conjugation
SureLight® APC. Ex: 652nm, Em: 657nm -
Specificity
ab92763 is reactive with EP4 receptor and non-reactive with EP1, EP2, and EP3 receptors. -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Cow, Chimpanzee, Cynomolgus monkey -
Immunogen
Synthetic peptide corresponding to Human PGE2 receptor EP4 subtype aa 459-488 (C terminal).
Sequence:GSGRAGPAPKGSSLQVTFPSETLNLSEKCI
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
pH: 7.20
Preservative: 0.013% Sodium azide
Constituents: 1.64% Sodium phosphate, 0.58% Sodium chloride -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab92763 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 5 µg/ml.
|
Notes |
---|
ICC/IF
Use a concentration of 5 µg/ml. |
Target
-
Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function. -
Tissue specificity
High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 450195 Chimpanzee
- Entrez Gene: 282331 Cow
- Entrez Gene: 5734 Human
- Entrez Gene: 100009081 Rabbit
- Omim: 601586 Human
- SwissProt: Q95KZ0 Chimpanzee
- SwissProt: Q8MJ08 Cow
- SwissProt: P35408 Human
see all -
Alternative names
- EP 4 antibody
- EP4 antibody
- EP4R antibody
see all
Images
-
ICC/IF image of ab92763 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1% BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab92763, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab92763 has been referenced in 3 publications.
- Xue P et al. PGE2/EP4 skeleton interoception activity reduces vertebral endplate porosity and spinal pain with low-dose celecoxib. Bone Res 9:36 (2021). PubMed: 34334792
- Chen H et al. Prostaglandin E2 mediates sensory nerve regulation of bone homeostasis. Nat Commun 10:181 (2019). PubMed: 30643142
- Ni S et al. Sensory innervation in porous endplates by Netrin-1 from osteoclasts mediates PGE2-induced spinal hypersensitivity in mice. Nat Commun 10:5643 (2019). PubMed: 31822662