Overview

  • Product name

    Anti-PGE2 receptor EP4 subtype antibody (SureLight® Allophycocyanin)
    See all PGE2 receptor EP4 subtype primary antibodies
  • Description

    Rabbit polyclonal to PGE2 receptor EP4 subtype (SureLight® Allophycocyanin)
  • Host species

    Rabbit
  • Conjugation

    SureLight® Allophycocyanin. Ex: 652nm, Em: 657nm
  • Specificity

    ab92763 is reactive with EP4 receptor and non-reactive with EP1, EP2, and EP3 receptors.
  • Tested applications

    Suitable for: ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Sheep, Human
    Predicted to work with: Rabbit, Cow, Chimpanzee, Cynomolgus monkey
  • Immunogen

    Synthetic peptide corresponding to Human PGE2 receptor EP4 subtype aa 459-488 (C terminal).
    Sequence:

    GSGRAGPAPKGSSLQVTFPSETLNLSEKCI

  • General notes

     This product was previously labelled as Prostaglandin E Receptor EP4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab92763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 µg/ml.
Flow Cyt Use a concentration of 3 µg/ml.

Target

Images

  • ICC/IF image of ab92763 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1% BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab92763, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

Answer

Thank you for your email and your interest in our products. I am sorry for the delay in my reply.

The peptide sequence used to raise the anti-Prostaglandin E Receptor EP4 antibody (ab92763) is SLRTQDATQTSCSTQSDASKQADL and the sequence for the anti-Prostaglandin E Receptor EP2 antibody (ab92755) is GSGRAGPAPKGSSLQVTFPSETLNLSEKCI. These peptides were taken from the residues 459-488 and 335-358 of the human proteins respectively. As you have noted, these regions are both within the cytoplasmic region of the proteins. However, this does not necessarily mean that they would not be suitable for use in Flow Cytometry. It just means that permiabilisation of the cells is likely to be required in order to allow the antibody to reach its target. With these antibodies, we employed 0.1-0.3% Triton X100 to permeabilize the membranes of cells (0.1%) or platelets (0.3%) in order to allow the antibody to penetrate the cell.

I hope this information has been of help. If you require any further information, please do not hesitate to contact us again.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up