Anti-PGEA1 antibody (ab230304)
Key features and details
- Rabbit polyclonal to PGEA1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-PGEA1 antibody -
Description
Rabbit polyclonal to PGEA1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein corresponding to Human PGEA1 aa 1-126.
Sequence:MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQ SLKFENGQWIAETGVSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLD MLSESTAESHLMEKELDELRISRKRK
Database link: Q9Y3M2 -
Positive control
- WB: Mouse lung lysate. IHC-P: Human heart tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab230304 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Detects a band of approximately 14 kDa (predicted molecular weight: 14 kDa). | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Inhibits the Wnt/Wingless pathway by binding to beta-catenin and inhibiting beta-catenin-mediated transcriptional activation through competition with TCF/LEF transcription factors. Has also been shown to play a role in regulating the intracellular trafficking of polycystin-2/PKD2 and possibly of other intracellular proteins. Promotes adipocyte and cardiomyocyte differentiation. -
Tissue specificity
Widely expressed. Expressed at higher levels in heart, skeletal muscle, kidney and placenta. Also found in brain, lung, liver and testis. Significantly down-regulated in thyroid and metastatic uterine tumors. -
Sequence similarities
Belongs to the chibby family. -
Cellular localization
Nucleus speckle. Golgi apparatus, trans-Golgi network. Nuclear, in a punctate manner. Also found in the trans-Golgi. - Information by UniProt
-
Database links
- Entrez Gene: 282859 Cow
- Entrez Gene: 25776 Human
- Entrez Gene: 73739 Mouse
- Omim: 607757 Human
- SwissProt: Q8MJK1 Cow
- SwissProt: Q9Y3M2 Human
- SwissProt: Q9D1C2 Mouse
- Unigene: 334911 Human
see all -
Alternative names
- ARPP-binding protein antibody
- C22orf2 antibody
- CBY antibody
see all
Images
-
Anti-PGEA1 antibody (ab230304) at 1/1000 dilution + Mouse lung lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 14 kDa
Observed band size: 14 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGEA1 antibody (ab230304)
Paraffin-embedded human heart tissue stained for PGEA1 using ab230304 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230304 has not yet been referenced specifically in any publications.