Overview

  • Product name

  • Description

    Rabbit polyclonal to PGK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Pig, Chimpanzee, Cynomolgus monkey, Chinese hamster, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human PGK1 aa 2-417. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    SLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCL DNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVG PEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFR ASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKAL ESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNM EIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQA TVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARG TKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLE LLEGKVLPGVDALSNI


    Database link: P00558

  • Positive control

    • WB: Recombinant human PGK1 protein; HeLa, HepG2 and HEK-293T cell lysates. IHC-P: Human cerebrum, colorectal cancer, glioma, liver and kidney tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 45 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-PGK1 antibody (ab233135) at 2 µg/ml + Recombinant human PGK1 protein

    Predicted band size: 45 kDa

  • All lanes : Anti-PGK1 antibody (ab233135) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 45 kDa

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for PGK1 using ab233135 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for PGK1 using ab233135 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for PGK1 using ab233135 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PGK1 using ab233135 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PGK1 using ab233135 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PGK1 (green) using ab233135 at 20 μg/ml in ICC/IF. FITC labeling.

References

ab233135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up