Overview

  • Product name

  • Description

    Rabbit polyclonal to PGLS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human PGLS aa 1-258.
    Sequence:

    MAAPAPGLISVFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSL VSMLARELPAAVAPAGPASLARWTLGFCDERLVPFDHAESTYGLYRTHLL SRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVG PDGHTCSLFPDHPLLQEREKIVAPISDSPKPPPQRVTLTLPVLNAARTVI FVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTV PFEKHSTL


    Database link: O95336

  • Positive control

    • WB: Mouse liver and brain lysates; U-251 MG, THP-1, HepG2 and HeLa whole cell lysates. IHC-P: Human thyroid and tonsil tissues. IP: U-251 MG whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab229980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 28 kDa.
IP 1/200 - 1/2000.

Target

Images

  • All lanes : Anti-PGLS antibody (ab229980) at 1/1000 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 4 : THP-1 (human monocytic leukemia cell line) whole cell lysate
    Lane 5 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 6 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 28 kDa
    Observed band size: 28,52 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human thyroid tissue stained for PGLS using ab229980 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human tonsil tissue stained for PGLS using ab229980 at 1/100 dilution in immunohistochemical analysis.

  • PGLS was immunoprecipitated from 500 µg U-251 MG (human brain glioma cell line) whole cell lysate with 4 µg ab229980. 

    Lane 1: Rabbit monoclonal IgG (1 µg) IP in U-251 MG whole cell lysate.

    Lane 2: ab229980 IP in U-251 MG whole cell lysate.

    Lane 3: U-251 MG whole cell lysate 20 µg (Input).

    For western blotting, an HRP-conjugated light chain specific antibody was used as the Secondary antibody at 1/50000 dilution.

References

ab229980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up