Overview

  • Product name

  • Description

    Rabbit polyclonal to PGM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PGM1 aa 1-235. Expressed in E.coli. N-terminal tags.
    Sequence:

    MVKIVTVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPA QRQEATLVVGGDGRFYMKEAIQLIARIAAANGIGRLVIGQNGILSTPAVS CIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQI SKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLR SIFDFSALKELLSGPNRLKIRIDAMHGVVGPYVKK


    Database link: P36871

  • Positive control

    • WB: Recombinant human PGM1 protein; HeLa and HEK-293T cell lysates; Pig liver lysate. IHC-P: Human cerebrum, liver, kidney, stomach, breast cancer and prostate tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 61 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • All lanes : Anti-PGM1 antibody (ab232959) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lanes 3-4 : Pig liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 61 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PGM1 using ab232959 at 10 μg/ml in immunohistochemical analysis.

    Secomdary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for PGM1 using ab232959 at 10 μg/ml in immunohistochemical analysis.

    Secomdary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PGM1 using ab232959 at 10 μg/ml in immunohistochemical analysis.

    Secomdary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for PGM1 using ab232959 at 10 μg/ml in immunohistochemical analysis.

    Secomdary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for PGM1 using ab232959 at 10 μg/ml in immunohistochemical analysis.

    Secomdary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for PGM1 using ab232959 at 10 μg/ml in immunohistochemical analysis.

    Secomdary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-PGM1 antibody (ab232959) at 1 µg/ml + Recombinant human PGM1 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 61 kDa

References

ab232959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up