Overview

  • Product name

    Anti-PGM1 antibody [CL3299]
    See all PGM1 primary antibodies
  • Description

    Mouse monoclonal [CL3299] to PGM1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human PGM1 aa 400-478.
    Sequence:

    SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALM FDRSFVGKQFSANDKVYTVEKADNFEYSD


    Database link: P36871

  • Epitope

    Binds to an epitope located within the peptide sequence HGRNFFTRYD as determined by overlapping synthetic peptides.
  • Positive control

    • WB: RT4 (human urinary bladder cancer cell line) cell lysate. IHC-P: Human skeletal muscle, liver, colon and prostate tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab223469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000.

Target

Images

  • Anti-PGM1 antibody [CL3299] (ab223469) at 1/500 dilution + RT4 (human urinary bladder cancer cell line) cell lysate
  • Paraffin embedded human colon stained for PGM1 with ab223469 at a 1/2500 dilution in Immunohistochemical analysis.

  • Paraffin embedded human prostate stained for PGM1 with ab223469 at a 1/2500 dilution in Immunohistochemical analysis.

  • Paraffin embedded human skeletal muscle stained for PGM1 with ab223469 at a 1/2500 dilution in Immunohistochemical analysis.

  • Paraffin embedded human liver stained for PGM1 with ab223469 at a 1/2500 dilution in Immunohistochemical analysis.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up