Anti-PGM3 antibody - C-terminal (ab193007)
Key features and details
- Rabbit polyclonal to PGM3 - C-terminal
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PGM3 antibody - C-terminal
See all PGM3 primary antibodies -
Description
Rabbit polyclonal to PGM3 - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human PGM3 aa 492-542 (C terminal). The exact sequence is proprietary. (NP_056414.1).
Sequence:RAFVRPSGTEDVVRVYAEADSQESADHLAHEVSLAVFQLAGGIGERPQPG F
Database link: O95394 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab193007 was affinity purified using an epitope specific to PGM3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab193007 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/10000. Predicted molecular weight: 60 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Interconverts GlcNAc-6-P and GlcNAc-1-P. -
Tissue specificity
Found in many tissues except lung. Relatively high expression in pancreas, heart, liver, and placenta, and relatively low expression in brain, skeletal muscle and kidney. -
Pathway
Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D-glucosamine biosynthesis; N-acetyl-alpha-D-glucosamine 1-phosphate from alpha-D-glucosamine 6-phosphate (route I): step 2/2. -
Sequence similarities
Belongs to the phosphohexose mutase family. - Information by UniProt
-
Database links
- Entrez Gene: 101137583 Gorilla
- Entrez Gene: 5238 Human
- Entrez Gene: 100448179 Orangutan
- Entrez Gene: 694464 Rhesus monkey
- Omim: 172100 Human
- SwissProt: O95394 Human
- Unigene: 661665 Human
-
Alternative names
- 2810473H05Rik antibody
- Acetylglucosamine phosphomutase antibody
- Agm1 antibody
see all
Images
-
All lanes : Anti-PGM3 antibody - C-terminal (ab193007) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 60 kDa
Exposure time: 3 minutesLysates prepared using NETN lysis buffer.
-
Detection of PGM3 in immunoprecipitates of 293T whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab193007 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot detection (Lane 1). Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 30 seconds.
Protocols
Datasheets and documents
References (0)
ab193007 has not yet been referenced specifically in any publications.