Anti-PGP antibody (ab234884)
Key features and details
- Rabbit polyclonal to PGP
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PGP antibody
See all PGP primary antibodies -
Description
Rabbit polyclonal to PGP -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant fragment corresponding to Human PGP aa 140-300.
Sequence:SVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQ QPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRF IFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDV KNNQESDCVSK
Database link: A6NDG6 -
Positive control
- IHC-P: Human tonsil tissue. ICC/IF: MCF7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab234884 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/20 - 1/200. |
Target
-
Tissue specificity
Detected in all tissues including red cells, lymphocytes and cultured fibroblasts (at protein level). The highest activities occur in skeletal muscle and cardiac muscle. -
Sequence similarities
Belongs to the HAD-like hydrolase superfamily. CbbY/CbbZ/Gph/YieH family. - Information by UniProt
-
Database links
- Entrez Gene: 283871 Human
- Entrez Gene: 67078 Mouse
- Entrez Gene: 287115 Rat
- Omim: 172280 Human
- SwissProt: A6NDG6 Human
- SwissProt: Q8CHP8 Mouse
- Unigene: 442634 Human
- Unigene: 28541 Mouse
see all -
Alternative names
- PGP antibody
- PGP_HUMAN antibody
- PGPase antibody
- Phosphoglycolate phosphatase antibody
Images
-
Paraffin-embedded human tonsil tissue stained for PGP using ab234884 at 1/100 dilution in immunohistochemical analysis.
-
MCF7 (human breast adenocarcinoma cell line) cells labeling PGP using ab234884 at 1/100 dilution in ICC/IF. Secondary antibody that was used was an Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab234884 has not yet been referenced specifically in any publications.