Overview

  • Product name

  • Description

    Mouse polyclonal to PGP9
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human PGP9 aa 1-596. (AAH17348.1)
    Sequence:

    MRLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDL WAACLYRSCLLLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMVK LLLFSEVRRPIRDPWFWALFVWTYISLGASFLLWWLLSTVRPGTQALEPG AATEAEGFPGSGRPPPEQASGATLQKLLSYTKPDVAFLVAASFFLIVAAL GETFLPYYTGRAIDGIVIQKSMDQFSTAVVIVCLLAIGSSFAAGIRGGIF TLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLV SQNINVFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYY KRLSKEVQNALARASNTAEETISAMKTVRSFANEEEEAEVYLRKLQQVYK LNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVISGQMTSGNLIAFII YEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHL EGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVN ILENFYPLEGGRVLLDGKPISAYDHKYLHRVVCARAWATLLRPFCI

  • Positive control

    • PGP9 transfected 293T cell lysate
  • General notes

     This product was previously labelled as ABCB9

     

Properties

Applications

Our Abpromise guarantee covers the use of ab167259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa.

Target

  • Relevance

    The membrane associated protein encoded by this gene is a member of the superfamily of ATP binding cassette (ABC) transporters. ABC proteins transport various molecules across extra and intra cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half transporter has not yet been determined; however, this protein may play a role in lysosomes. Alternative splicing of this gene results in three known products which are likely to have different substrate specifications.
  • Cellular localization

    Integral membrane protein. Lysosomal. May be localized in the endoplasmic reticulum.
  • Database links

  • Alternative names

    • ABC transporter 9 protein antibody
    • ABCB 9 antibody
    • ATP binding cassette sub family B (MDR/TAP) member 9 antibody
    • ATP binding cassette sub family B member 9 precursor antibody
    • ATP binding cassette transporter 9 antibody
    • EST122234 antibody
    • hABCB9 antibody
    • KIAA1520 antibody
    • TAP like protein antibody
    • TAPL antibody
    see all

Images

  • All lanes : Anti-PGP9 antibody (ab167259) at 1 µg/ml

    Lane 1 : PGP9 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 66 kDa

References

ab167259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up