Overview

  • Product name

  • Description

    Rabbit polyclonal to PGPEP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PGPEP1 aa 1-66.
    Sequence:

    MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVE YQTVQRLIPALWEKHS


    Database link: Q9NXJ5

  • Positive control

    • HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Removes 5-oxoproline from various penultimate amino acid residues except L-proline.
  • Sequence similarities

    Belongs to the peptidase C15 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810003H13Rik antibody
    • 5 oxoprolyl peptidase antibody
    • 5-oxoprolyl-peptidase antibody
    • FLJ20208 antibody
    • MGC10812 antibody
    • PAP I antibody
    • PAP-I antibody
    • PAPI antibody
    • Pcp antibody
    • PGI antibody
    • pGlu peptidase I antibody
    • PGP antibody
    • PGP I antibody
    • PGP-I antibody
    • Pgpep1 antibody
    • PGPI antibody
    • PGPI_HUMAN antibody
    • Pyroglutamyl aminopeptidase I antibody
    • Pyroglutamyl peptidase 1 antibody
    • pyroglutamyl peptidase I antibody
    • Pyroglutamyl-peptidase 1 antibody
    • Pyroglutamyl-peptidase I antibody
    • pyrrolidone carboxylate peptidase antibody
    • Pyrrolidone-carboxylate peptidase antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HepG2 cells labeling PGPEP1 with ab220735 at 4 µg/ml (green).

References

ab220735 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220735.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up