Overview

  • Product name

  • Description

    Rabbit polyclonal to PGPL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PGPL aa 146-295.
    Sequence:

    TPDRKLIFGKGNFEHLTEKIRGSPDITCVFLNVERMAAPTKKELEAAWGV EVFDRFTVVLHIFRCNARTKEARLQVALAEMPLHRSNLKRDVAHLYRGVG SRYIMGSGESFMQLQQRLLREKEAKIRKALDRLRKKRHLLRRQRTRREFP


    Database link: O43824

  • Positive control

    • WB: HeLa and A549 whole cell lysate. IHC-P: Human gastric cancer tissue.
  • General notes

     This product was previously labelled as GTPBP6

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/200. Predicted molecular weight: 57 kDa.
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the HflX GTPase family.
    Contains 1 G (guanine nucleotide-binding) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • GTP binding protein 6 (putative) antibody
    • GTPB6_HUMAN antibody
    • gtpbp6 antibody
    • PGPL antibody
    • Pseudoautosomal GTP-binding protein-like antibody
    • Putative GTP-binding protein 6 antibody
    see all

Images

  • All lanes : Anti-PGPL antibody (ab235771) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 57 kDa

  • Paraffin-embedded human gastric cancer tissue stained for PGPL with ab235771 at 1/100 dilution in immunohistochemical analysis.

References

ab235771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up