Overview

  • Product name

  • Description

    Rabbit polyclonal to PGRMC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PGRMC1 aa 49-123.
    Sequence:

    DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVF DVTKGRKFYGPEGPYGVFAGRDASR


    Database link: O00264

  • Positive control

    • IHC-P: Human liver, kidney, endometrium, hippocampus tissue and breast cancer tissue. WB: NIH/3T3, NBT-II and HEK-293 cell lysate. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 22 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin embedded human endometrium tissue stained for PGRMC1 with ab224054 (1/500 dilution) in immunohistochemical analysis.

  • Anti-PGRMC1 antibody (ab224054) at 1/100 dilution + HEK-293 (human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 22 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PGRMC1 (green) using ab224054 (4 µg/ml) in ICC/IF.

  • All lanes : Anti-PGRMC1 antibody (ab224054) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat cell line) cell lysate

    Predicted band size: 22 kDa

  • Negative control: Paraffin embedded skeletal tissue stained for PGRMC1 with ab224054 (1/500 dilution) in immunohistochemical analysis.

  • Paraffin embedded human liver tissue stained for PGRMC1 with ab224054 (1/500 dilution) in immunohistochemical analysis.

  • Paraffin embedded human kidney tissue stained for PGRMC1 with ab224054 (1/500 dilution) in immunohistochemical analysis.

  • Paraffin embedded human breast cancer tissue stained for PGRMC1 with ab224054 (1/500 dilution) in immunohistochemical analysis.

  • Paraffin embedded human hippocampus tissue stained for PGRMC1 with ab224054 (1/500 dilution) in immunohistochemical analysis.

References

ab224054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up