Overview

  • Product name

    Anti-PGRMC1 antibody - C-terminal
    See all PGRMC1 primary antibodies
  • Description

    Rabbit polyclonal to PGRMC1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Sheep, Rabbit, Horse, Cow, Cat, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Orangutan
  • Immunogen

    Synthetic peptide within Human PGRMC1 aa 145-195 (C terminal). The exact sequence is proprietary. (NP_006658.1).
    Sequence:

    LTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKN D


    Database link: O00264

  • Positive control

    • HeLa, Jurkat, 293T and NIH3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab194879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/1000 - 1/5000. Predicted molecular weight: 22 kDa.

Target

Images

  • All lanes : Anti-PGRMC1 antibody - C-terminal (ab194879) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 22 kDa


    Exposure time: 30 seconds


    Lysates in lanes 1-3 were prepared using RIPA lysis buffer. Lysates in lanes 4-5 were prepared using NETN lysis buffer.

     

     

  • Detection of PGRMC1 in immunoprecipitates of 293T whole cell lysate prepared using RIPA lysis buffer (1 mg for IP, 20% of IP loaded) using ab194879 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot detection (Lane 1). Lane 2 represents control IgG IP.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab194879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up