Anti-PGRPS antibody (ab232728)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PGRPS antibody
See all PGRPS primary antibodies -
Description
Rabbit polyclonal to PGRPS -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Rat PGRPS aa 18-183. Two N-terminal tags, (Expressed in E.coli).
Sequence:CCFVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARN VQLYQMKQLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGI TFMGDYSHRVPAKRALRAALNLLKCGVSEGFLRSNYEVKGHRDVQSTLSP GDQLYEIIQSWDHYRE
Database link: Q9JLN4 -
Positive control
- WB: Human urine; Recombinant rat PGRPS protein. IHC-P: Rat spleen tissue. ICC/IF: HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab232728 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 5 µg/ml. | |
| ICC/IF | Use a concentration of 5 - 20 µg/ml. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity. -
Tissue specificity
Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils. -
Sequence similarities
Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. -
Post-translational
modificationsN-glycosylated. N-glycosylation is required for bactericidal activity. -
Cellular localization
Secreted. Cytoplasmic granule. - Information by UniProt
-
Database links
- Entrez Gene: 8993 Human
- Entrez Gene: 84387 Rat
- Omim: 604963 Human
- SwissProt: O75594 Human
- SwissProt: Q9JLN4 Rat
- Unigene: 137583 Human
- Unigene: 2834 Rat
-
Alternative names
- MGC126894 antibody
- MGC126896 antibody
- Peptidoglycan recognition protein 1 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-PGRPS antibody (ab232728)Paraformaldehyde-fixed HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PGRPS using ab232728 at 20 µg/mL in ICC/IF. FITC staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PGRPS antibody (ab232728)Formalin-fixed, paraffin-embedded rat spleen tissue stained for PGRPS using ab232728 at 20 µg/mL in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-PGRPS antibody (ab232728)Anti-PGRPS antibody (ab232728) at 3 µg/ml + Human urine
Secondary
HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution -
Western blot - Anti-PGRPS antibody (ab232728)Anti-PGRPS antibody (ab232728) at 3 µg/ml + Recombinant rat PGRPS protein
Datasheets and documents
References
ab232728 has not yet been referenced specifically in any publications.
