Overview

  • Product name

  • Description

    Rabbit polyclonal to PGRPS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human PGRPS aa 22-196. (Expressed in E.coli).
    Sequence:

    QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPA SCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHL WNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHR DVQRTLSPGNQLYHLIQNWPHYRS


    Database link: O75594

  • Positive control

    • IHC-P: Human liver cancer tissue. WB: Human urine; Recombinant human PGRPS protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 22 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity.
  • Tissue specificity

    Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils.
  • Sequence similarities

    Belongs to the N-acetylmuramoyl-L-alanine amidase 2 family.
  • Post-translational
    modifications

    N-glycosylated. N-glycosylation is required for bactericidal activity.
  • Cellular localization

    Secreted. Cytoplasmic granule.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC126894 antibody
    • MGC126896 antibody
    • Peptidoglycan recognition protein 1 antibody
    • Peptidoglycan recognition protein antibody
    • Peptidoglycan recognition protein short antibody
    • PGLYRP antibody
    • PGLYRP1 antibody
    • PGRP antibody
    • PGRP S antibody
    • PGRP-S antibody
    • PGRP1_HUMAN antibody
    • PHRP, short antibody
    • SBBI68 antibody
    • TAG7 antibody
    • TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein) antibody
    • TNFSF 3L antibody
    • TNFSF3L antibody
    • UNQ639/PRO1269 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for PGRPS using ab232948 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PGRPS antibody (ab232948) at 2 µg/ml + Recombinant human PGRPS protein

    Predicted band size: 22 kDa

  • Anti-PGRPS antibody (ab232948) at 2 µg/ml + Human urine

    Predicted band size: 22 kDa

References

ab232948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up