Anti-PGT antibody (ab150788)
Key features and details
- Rabbit polyclonal to PGT
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PGT antibody -
Description
Rabbit polyclonal to PGT -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PGT aa 431-513.
Sequence:PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMS SATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH
-
Positive control
- RT-4 and U-251 MG lysates; Human kidney tissue.
-
General notes
Previously labelled as SLCO2A1.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab150788 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
WB |
1/250 - 1/500. Predicted molecular weight: 70 kDa.
|
Notes |
---|
IHC-P
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
WB
1/250 - 1/500. Predicted molecular weight: 70 kDa. |
Target
-
Cellular localization
Cell Membrane -
Database links
- Entrez Gene: 6578 Human
- Omim: 601460 Human
- SwissProt: Q92959 Human
- Unigene: 518270 Human
-
Alternative names
- MATR1 antibody
- Matrin F/G 1 antibody
- OATP2A1 antibody
see all
Images
-
Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling PGT with ab150788 at 1/10 dilution.
-
All lanes : Anti-PGT antibody (ab150788) at 1/250 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Liver tissue lysate
Lane 5 : Tonsil tissue lysate
Predicted band size: 70 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab150788 has not yet been referenced specifically in any publications.