Overview

  • Product name

    Anti-PGT antibody
  • Description

    Rabbit polyclonal to PGT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PGT aa 431-513.
    Sequence:

    PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMS SATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH

  • Positive control

    • RT-4 and U-251 MG lysates; Human kidney tissue.
  • General notes

    Previously labelled as SLCO2A1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab150788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 70 kDa.

Target

  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • MATR1 antibody
    • Matrin F/G 1 antibody
    • OATP2A1 antibody
    • PGT antibody
    • PHOAR2 antibody
    • Prostaglandin transporter antibody
    • SLC21A2 antibody
    • SLCO2A1 antibody
    • Solute carrier family 21 (prostaglandin transporter) member 2 antibody
    • Solute carrier family 21 member 2 antibody
    • Solute carrier organic anion transporter family member 2A1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling PGT with ab150788 at 1/10 dilution.

  • All lanes : Anti-PGT antibody (ab150788) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Liver tissue lysate
    Lane 5 : Tonsil tissue lysate

    Predicted band size: 70 kDa

References

ab150788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab150788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up