Overview

  • Product name

  • Description

    Rabbit polyclonal to PHAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human PHAP1 aa 2-175. Expressed in E.coli. N-terminal tag.
    Sequence:

    EMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTIN VGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIK DLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRD DKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEE DVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD


    Database link: P39687

  • Positive control

    • WB: Recombinant human PHAP1 protein; Mouse brain, cerebellum and lung lysates. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 29 kDa.

Target

  • Function

    Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression.
  • Tissue specificity

    Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate nucleus, corpus callosum, hippocampus and thalamus), with highest levels in amygdala.
  • Sequence similarities

    Belongs to the ANP32 family.
    Contains 4 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Post-translational
    modifications

    Phosphorylated on serine residues.
    The N-terminus is blocked.
    Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group.
  • Cellular localization

    Nucleus. Cytoplasm. Endoplasmic reticulum. Translocates to the cytoplasm during the process of neuritogenesis (By similarity). Shuttles between nucleus and cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • acidic (leucine-rich) nuclear phosphoprotein 32 family, member A antibody
    • Acidic leucine-rich nuclear phosphoprotein 32 family member A antibody
    • Acidic nuclear phosphoprotein 32 family member A antibody
    • Acidic nuclear phosphoprotein pp32 antibody
    • AN32A_HUMAN antibody
    • ANP32A antibody
    • C15orf1 antibody
    • Cerebellar leucine rich acidic nuclear protein antibody
    • Hepatopoietin Cn antibody
    • HPPCn antibody
    • I1PP2A antibody
    • Inhibitor 1 of protein phosphatase 2A antibody
    • inhibitor-1 of protein phosphatase-2A antibody
    • Lanp antibody
    • Leucine rich acidic nuclear protein antibody
    • Leucine-rich acidic nuclear protein antibody
    • MAPM antibody
    • Mapmodulin antibody
    • MGC119787 antibody
    • MGC150373 antibody
    • PHAPI antibody
    • Potent heat stable protein phosphatase 2A inhibitor I1PP2A antibody
    • Potent heat-stable protein phosphatase 2A inhibitor I1PP2A antibody
    • PP32 antibody
    • Putative HLA DR associated protein I antibody
    • Putative HLA-DR-associated protein I antibody
    • Putative human HLA class II associated protein I antibody
    • Putative human HLA class II-associated protein antibody
    see all

Images

  • All lanes : Anti-PHAP1 antibody (ab232973) at 2 µg/ml

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse cerebellum lysate
    Lane 3 : Mouse lung lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 29 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PHAP1 using ab232973 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PHAP1 antibody (ab232973) at 2 µg/ml + Recombinant human PHAP1 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 29 kDa

References

ab232973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up