Anti-PHD2 / prolyl hydroxylase antibody (ab244389)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PHD2 / prolyl hydroxylase antibody
See all PHD2 / prolyl hydroxylase primary antibodies -
Description
Rabbit polyclonal to PHD2 / prolyl hydroxylase -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human PHD2/ prolyl hydroxylase aa 206-294.
Sequence:GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDK ITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING
Database link: Q9GZT9 -
Positive control
- ICC/IF: U-251 MG cells. IHC-P: Human colon tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab244389 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF-1 alpha at 'Pro-402' and 'Pro-564', and HIF-2 alpha. Functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. -
Tissue specificity
According to PubMed:11056053, widely expressed with highest levels in skeletal muscle and heart, moderate levels in pancreas, brain (dopaminergic neurons of adult and fetal substantia nigra) and kidney, and lower levels in lung and liver. According to PubMed:12351678 widely expressed with highest levels in brain, kidney and adrenal gland. Expressed in cardiac myocytes, aortic endothelial cells and coronary artery smooth muscle. -
Involvement in disease
Defects in EGLN1 are the cause of erythrocytosis familial type 3 (ECYT3) [MIM:609820]. ECYT3 is an autosomal dominant disorder characterized by increased serum red blood cell mass, elevated serum hemoglobin and hematocrit, and normal serum erythropoietin levels. -
Sequence similarities
Contains 1 Fe2OG dioxygenase domain.
Contains 1 MYND-type zinc finger. - Information by UniProt
-
Database links
- Entrez Gene: 54583 Human
- Entrez Gene: 112405 Mouse
- Entrez Gene: 308913 Rat
- Omim: 606425 Human
- SwissProt: Q9GZT9 Human
- SwissProt: Q91YE3 Mouse
- SwissProt: P59722 Rat
- Unigene: 444450 Human
see all -
Alternative names
- C1ORF12 antibody
- Chromosome 1 Open Reading Frame 12 antibody
- DKFZp761F179 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PHD2 / prolyl hydroxylase antibody (ab244389)Paraffin-embedded human colon tissue stained for PHD2 / prolyl hydroxylase using ab244389 at 1/20 dilution in immunohistochemical analysis. -
Immunocytochemistry/ Immunofluorescence - Anti-PHD2 / prolyl hydroxylase antibody (ab244389)PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for PHD2 / prolyl hydroxylase (green) using ab244389 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab244389 has not yet been referenced specifically in any publications.
