Overview

  • Product name
    Anti-PHF19 antibody - C-terminal
    See all PHF19 primary antibodies
  • Description
    Rabbit polyclonal to PHF19 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Horse, Cow, Dog, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human PHF19 aa 530-580 (C terminal). The exact sequence is proprietary. (NP_056466.1).
    Sequence:

    SSLSHLKSSITNYFGAAGRLACGEKYQVLARRVTPEGKVQYLVEWEGTTP Y


    Database link: Q5T6S3

  • Positive control
    • Jurkat, HeLa, 293T, mouse TCMK-1 and mouse NIH3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab177518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 66 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function
      Acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
    • Tissue specificity
      Isoform 1 is expressed in thymus, heart, lung and kidney. Isoform 2 is predominantly expressed in placenta, skeletal muscle and kidney, whereas isoform 1 is predominantly expressed in liver and peripheral blood leukocytes. Overexpressed in many types of cancers, including colon, skin, lung, rectal, cervical, uterus, liver cancers, in cell lines derived from different stages of melanoma and in glioma cell lines.
    • Sequence similarities
      Contains 2 PHD-type zinc fingers.
    • Cellular localization
      Nucleus.
    • Information by UniProt
    • Database links
    • Alternative names
      • hPCL3 antibody
      • MGC131698 antibody
      • MGC149712 antibody
      • MGC149713 antibody
      • MGC23929 antibody
      • MTF2L1 antibody
      • OTTHUMP00000021996 antibody
      • OTTHUMP00000021998 antibody
      • PCL3 antibody
      • PHD finger protein 19 antibody
      • Phf19 antibody
      • PHF19 protein antibody
      • PHF19_HUMAN antibody
      • Polycomb like 3 antibody
      • Polycomb like protein 3 antibody
      • Polycomb-like protein 3 antibody
      • TDRD19B antibody
      • Tudor domain containing 19B antibody
      see all

    Images

    • All lanes : Anti-PHF19 antibody - C-terminal (ab177518) at 0.1 µg/ml

      Lane 1 : Jurkat whole cell lysate
      Lane 2 : HeLa whole cell lysate
      Lane 3 : 293T whole cell lysate
      Lane 4 : TCMK-1 whole cell lysate
      Lane 5 : NIH3T3 whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 66 kDa


      Exposure time: 30 seconds

    References

    ab177518 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Application
    Western blot
    Loading amount
    20 µg
    Gel Running Conditions
    Reduced Denaturing (10%)
    Sample
    Rat Cell lysate - whole cell (Primary hippocampal neurons)
    Specification
    Primary hippocampal neurons
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

    Abcam user community

    Verified customer

    Submitted Sep 03 2014

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up