Overview

  • Product name

    Anti-PHF5A antibody
  • Description

    Rabbit polyclonal to PHF5A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Arabidopsis thaliana
  • Immunogen

    Recombinant full length protein corresponding to Human PHF5A aa 1-110.
    Sequence:

    MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECN YGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFY ERKKYGFKKR


    Database link: Q7RTV0

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
ELISA Use at an assay dependent concentration.

Target

  • Function

    Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha. Also involved in pre-mRNA splicing.
  • Sequence similarities

    Belongs to the PHF5 family.
  • Cellular localization

    Nucleus. Nucleus speckle.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110007B08Rik antibody
    • Ac2 246 antibody
    • bK223H9.2 antibody
    • INI antibody
    • MGC1346 antibody
    • OTTHUMP00000198827 antibody
    • PHD finger 5a antibody
    • PHD finger like domain containing protein 5A antibody
    • PHD finger like domain protein 5A antibody
    • PHD finger protein 5A antibody
    • PHD finger-like domain protein 5A antibody
    • PHD finger-like domain-containing protein 5A antibody
    • Phf5a antibody
    • PHF5A_HUMAN antibody
    • Rds3 antibody
    • SAP14b antibody
    • SF3b14b antibody
    • Splicing factor 3B associated 14 kDa protein antibody
    • Splicing factor 3B-associated 14 kDa protein antibody
    • Transcription factor INI antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling PHF5A with ab193115 at 1/50 dilution.

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells labelling PHF5A with ab193115 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

References

This product has been referenced in:

  • Mao S  et al. PHD finger protein 5A promoted lung adenocarcinoma progression via alternative splicing. Cancer Med 8:2429-2441 (2019). Read more (PubMed: 30932358) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Sample
Arabidopsis thaliana Cell lysate - whole cell (leaves)
Gel Running Conditions
Reduced Denaturing (20% gel)
Loading amount
10 µg
Specification
leaves
Blocking step
(agent) for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 24°C

Dr. David Alabadi

Verified customer

Submitted Jun 30 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up