Overview

  • Product name

    Anti-PHGDH/Malate dehydrogenase antibody
    See all PHGDH/Malate dehydrogenase primary antibodies
  • Description

    Rabbit polyclonal to PHGDH/Malate dehydrogenase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Pig, Chimpanzee, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PHGDH/Malate dehydrogenase aa 193-306.
    Sequence:

    LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDE GALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQ SRCGEEIAVQFVDM


    Database link: O43175

  • Positive control

    • Human stomach tissue; NIH 3T3, MBT II, RT4 and U251 MG sp cell lystaes; U 2 OS cells.
  • General notes

     This product was previously labelled as PHGDH

     

Properties

Applications

Our Abpromise guarantee covers the use of ab211365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 57 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • Immunofluorescent analysis of U 2 OS cells cells (PFA-fixed/Triton X-100 permeabilized) labeling PHGDH/Malate dehydrogenase with ab211365 at 4 µg/ml.

  • All lanes : Anti-PHGDH/Malate dehydrogenase antibody (ab211365) at 0.4 µg/ml

    Lane 1 : SK-MEL-30 (Human cell line) cell lysate
    Lane 2 : A549 (Human lung carcinoma cell line) cell lysate

    Predicted band size: 57 kDa

References

This product has been referenced in:

  • Lu YX  et al. ME1 Regulates NADPH Homeostasis to Promote Gastric Cancer Growth and Metastasis. Cancer Res 78:1972-1985 (2018). Read more (PubMed: 29654155) »
  • Li S  et al. Astrocytes in primary cultures express serine racemase, synthesize d-serine and acquire A1 reactive astrocyte features. Biochem Pharmacol 151:245-251 (2018). Read more (PubMed: 29305854) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up