Overview

  • Product name

  • Description

    Rabbit polyclonal to PHKG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PHKG2 aa 280-358.
    Sequence:

    LTAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTVLAAGRVALSTHRVR PLTKNALLRDPYALRSVRHLIDNCAFRLY


    Database link: P15735

  • Positive control

    • RT-4 and U-251 MG cell lysates; Human liver lysate; MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 46 kDa.

Target

  • Relevance

    Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • GSD9C antibody
    • PHK gamma LT antibody
    • PHK gamma T antibody
    • Phosphorylase b kinase gamma catalytic chain testis/liver isoform antibody
    • Phosphorylase b kinase gamma catalytic chain, liver/testis isoform antibody
    • Phosphorylase kinase catalytic subunit gamma 2 antibody
    • Phosphorylase kinase gamma subunit 2 antibody
    • Phosphorylase kinase subunit gamma 2 antibody
    • Phosphorylase kinase, gamma 2 (testis) antibody
    • Phosphorylase kinase, gamma 2 (testis/liver) antibody
    • PSK C3 antibody
    • Serine/threonine protein kinase PHKG2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling PHKG2 with ab221384 at 4 μg/ml (green).

  • All lanes : Anti-PHKG2 antibody (ab221384) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate

    Predicted band size: 46 kDa

References

ab221384 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221384.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up