Overview

  • Product name
  • Description
    Rabbit polyclonal to PHKG2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human PHKG2 aa 8-57 (N terminal). The exact sequence is proprietary.
    Sequence:

    EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV


    Database link: P15735

  • Positive control
    • HepG2 cell lysate and human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab28642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 40 kDa (predicted molecular weight: 46 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Relevance
    Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
  • Cellular localization
    Cytoplasmic
  • Database links
  • Alternative names
    • GSD9C antibody
    • PHK gamma LT antibody
    • PHK gamma T antibody
    • Phosphorylase b kinase gamma catalytic chain testis/liver isoform antibody
    • Phosphorylase b kinase gamma catalytic chain, liver/testis isoform antibody
    • Phosphorylase kinase catalytic subunit gamma 2 antibody
    • Phosphorylase kinase gamma subunit 2 antibody
    • Phosphorylase kinase subunit gamma 2 antibody
    • Phosphorylase kinase, gamma 2 (testis) antibody
    • Phosphorylase kinase, gamma 2 (testis/liver) antibody
    • PSK C3 antibody
    • Serine/threonine protein kinase PHKG2 antibody
    see all

Images

  • Anti-PHKG2 antibody (ab28642) at 0.5 µg/ml + HepG2 Cell Lysate

    Predicted band size: 46 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling PHKG2 with ab28642 at 4-8µg/ml.

References

ab28642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab28642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up