Overview

  • Product name

  • Description

    Rabbit polyclonal to PHLDA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PHLDA1 aa 246-307.
    Sequence:

    KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKST RQKQQHLVQQQP


    Database link: Q8WV24

  • Positive control

    • ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Seems to be involved in regulation of apoptosis. May be involved in detachment-mediated programmed cell death. May mediate apoptosis during neuronal development. May be involved in regulation of anti-apoptotic effects of IGF1. May be involved in translational regulation.
  • Tissue specificity

    Widely expressed with highest levels in pancreas. Strongly expressed by benign melanocytic nevi, and progressively reduced expressed in primary and metastatic melanomas (at protein level).
  • Sequence similarities

    Contains 1 PH domain.
  • Cellular localization

    Cytoplasm. Cytoplasmic vesicle. Nucleus, nucleolus. Colocalizes with intracellular vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apoptosis associated nuclear protein antibody
    • Apoptosis-associated nuclear protein antibody
    • DT1P1B11 antibody
    • MGC131738 antibody
    • PHLA1_HUMAN antibody
    • PHLDA1 antibody
    • PHRIP antibody
    • Pleckstrin homology like domain family A member 1 antibody
    • Pleckstrin homology-like domain family A member 1 antibody
    • PQ rich protein antibody
    • PQ-rich protein antibody
    • PQR protein antibody
    • Proline- and glutamine-rich protein antibody
    • Proline- and histidine-rich protein antibody
    • T cell death associated gene antibody
    • T CELL DEATH ASSOCIATED GENE 51 antibody
    • T-cell death-associated gene 51 protein antibody
    • Tdag antibody
    • TDAG51 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized PC-3 (human prostate adenocarcinoma cell line) cells stained for PHLDA1 (green) using ab244526 at 4 µg/ml in ICC/IF.

References

ab244526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Dental tissues)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citric buffer
Permeabilization
Yes - Tween and SDS
Specification
Dental tissues
Blocking step
(agent) for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Oct 01 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up