Anti-PHLDA1 antibody (ab244526)
Key features and details
- Rabbit polyclonal to PHLDA1
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PHLDA1 antibody
See all PHLDA1 primary antibodies -
Description
Rabbit polyclonal to PHLDA1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human PHLDA1 aa 246-307.
Sequence:KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKST RQKQQHLVQQQP
Database link: Q8WV24 -
Positive control
- ICC/IF: PC-3 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244526 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Seems to be involved in regulation of apoptosis. May be involved in detachment-mediated programmed cell death. May mediate apoptosis during neuronal development. May be involved in regulation of anti-apoptotic effects of IGF1. May be involved in translational regulation. -
Tissue specificity
Widely expressed with highest levels in pancreas. Strongly expressed by benign melanocytic nevi, and progressively reduced expressed in primary and metastatic melanomas (at protein level). -
Sequence similarities
Contains 1 PH domain. -
Cellular localization
Cytoplasm. Cytoplasmic vesicle. Nucleus, nucleolus. Colocalizes with intracellular vesicles. - Information by UniProt
-
Database links
- Entrez Gene: 22822 Human
- Entrez Gene: 21664 Mouse
- Entrez Gene: 29380 Rat
- Omim: 605335 Human
- SwissProt: Q8WV24 Human
- SwissProt: Q62392 Mouse
- SwissProt: Q9QZA1 Rat
- Unigene: 602085 Human
see all -
Alternative names
- Apoptosis associated nuclear protein antibody
- Apoptosis-associated nuclear protein antibody
- DT1P1B11 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-PHLDA1 antibody (ab244526)
PFA-fixed, Triton X-100 permeabilized PC-3 (human prostate adenocarcinoma cell line) cells stained for PHLDA1 (green) using ab244526 at 4 µg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244526 has not yet been referenced specifically in any publications.
