Overview

  • Product name

  • Description

    Rabbit polyclonal to PHLDB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PHLDB2 aa 823-917.
    Sequence:

    NPNTLKEGYISVNEINEPCGNSTNLSPSTQFPADADAVATEPATAVLASQ PQSKEHFRSLEERKKQHKEGLYLSDTLPRKKTTSSISPHFSSATM


    Database link: Q86SQ0

  • Positive control

    • A431 cells; Human stomach upper tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab202350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Use under non reducing condition. Detects a band of approximately 142 kDa (predicted molecular weight: 142 kDa).
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Seems to be involved in the assembly of the postsynaptic apparatus. May play a role in acetyl-choline receptor (AChR) aggregation in the postsynaptic membrane.
  • Sequence similarities

    Contains 1 PH domain.
  • Domain

    The PH domain mediates the binding to phosphoinositides.
  • Cellular localization

    Cytoplasm. Membrane. Translocates to the plasma membrane at high levels of PtdIns(3,4,5)P3. At low levels of PtdIns(3,4,5)P3 is translocated to vesicular compartments.
  • Information by UniProt
  • Database links

  • Alternative names

    • LL5 beta antibody
    • LL5B antibody
    • LL5beta antibody
    • PHLB2_HUMAN antibody
    • PHLDB2 antibody
    • Pleckstrin homology-like domain family B member 2 antibody
    • Protein LL5-beta antibody
    see all

Images

  • Anti-PHLDB2 antibody (ab202350) + Human cell line U-2 OS

    Predicted band size: 142 kDa
    Observed band size: 142 kDa



    Recommended conditions:

    Dilution: 1:100 - 1:250
  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling PHLDB2 with ab202350 at 4 µg/ml (green).

  • Immunohistochemical analysis of paraffin-embedded Human stomach upper tissue labeling PHLDB2 with ab202350 at 1/20 dilution.

References

ab202350 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up