Anti-Phosphate-binding protein PstS 1 antibody (HRP) (ab193412)

Overview

  • Product name

    Anti-Phosphate-binding protein PstS 1 antibody (HRP)
  • Description

    Rabbit polyclonal to Phosphate-binding protein PstS 1 (HRP)
  • Host species

    Rabbit
  • Conjugation

    HRP
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein corresponding to Phosphate-binding protein PstS 1 aa 24-373. Mycobacterium tuberculosis.
    Sequence:

    CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFH ERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNI ALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGV NLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVP GALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNF LLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQ KDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS


    Database link: P9WGU1

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/300. Predicted molecular weight: 38 kDa.

Target

  • Relevance

    Part of the ABC transporter complex PstSACB involved in phosphate import
  • Cellular localization

    Cell Membrane
  • Alternative names

    • Antigen Ag78 antibody
    • PAB antibody
    • phoS antibody
    • phoS1 antibody
    • phosphate ABC transporter substrate-binding lipoprotein PstS antibody
    • Protein antigen B antibody
    • pstS1 antibody
    see all

References

ab193412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up