Overview

  • Product name

    Anti-Phosphatidic acid phosphatase type 2B antibody
    See all Phosphatidic acid phosphatase type 2B primary antibodies
  • Description

    Rabbit polyclonal to Phosphatidic acid phosphatase type 2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Phosphatidic acid phosphatase type 2B aa 275-311.
    Sequence:

    SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM


    Database link: O14495

  • Positive control

    • WB: RT4 whole cell lysate. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 35 kDa.

Target

  • Function

    Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA = PA > C-1-P > S-1-P. May be involved in cell adhesion and in cell-cell interactions.
  • Tissue specificity

    Ubiquitously expressed. Highly expressed in heart and placenta.
  • Sequence similarities

    Belongs to the PA-phosphatase related phosphoesterase family.
  • Post-translational
    modifications

    N-glycosylated. Contains high-mannose oligosaccharides.
  • Cellular localization

    Golgi apparatus > trans-Golgi network membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dri 42 antibody
    • Dri42 antibody
    • Lipid phosphate phosphohydrolase 3 antibody
    • LPP3 antibody
    • LPP3_HUMAN antibody
    • PAP 2b antibody
    • PAP-2b antibody
    • PAP2 beta antibody
    • PAP2-beta antibody
    • PAP2b antibody
    • Phosphatidate phosphohydrolase type 2b antibody
    • Phosphatidic acid phosphatase 2b antibody
    • Ppap2b antibody
    • type 2 phosphatidic acid phosphatase beta antibody
    • vascular endothelial growth factor and type I collagen inducible antibody
    • Vascular endothelial growth factor and type I collagen inducible protein antibody
    • Vascular endothelial growth factor and type I collagen-inducible protein antibody
    • VCIP antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for phosphatidic acid phosphatase type 2B (green) using ab221918 (4 µg/ml) in ICC/IF.

  • Anti-Phosphatidic acid phosphatase type 2B antibody (ab221918) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) whole cell lysate

    Predicted band size: 35 kDa

References

ab221918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up