Overview

  • Product name

    Anti-Phosphinotricin Acetyl Transferase antibody
  • Description

    Rabbit polyclonal to Phosphinotricin Acetyl Transferase
  • Host species

    Rabbit
  • Specificity

    Predicted to react with Streptomyces viridochromogenes.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
  • Immunogen

    Recombinant full length protein corresponding to Phosphinotricin Acetyl Transferase aa 1-183. Streptomyces viridochromogenes
    Sequence:

    MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDL ERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRL GLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRA AGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI


    Database link: Q57146

  • Positive control

    • WB: Recombinant protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab225957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

Target

  • Relevance

    The most commonly used selection markers in plant transformation are the bacterial bar gene encoding for the phosphinotricin acetyl transferase (PAT) and the gene encoding for neomycin phosphotransferase II (NPTII). The bar/pat gene was isolated from Streptomyces hygroscopicus. It encodes a small (21 kDa) protein. The pat gene confers resistance to the glufosinate ammonium herbicides bialaphos (BASTA), and phosphinotricin (PPT). PAT belongs to the family of acetyltransferases. It acetylates and inactivates the herbicides bialaphos and PPT. PAT can be used to detect relative transfection efficiencies in cells where multiple transfections are performed in parallel with different plasmids. PAT has been used routinely as a resistance gene in the production of genetically engineered crops and for the production of herbicide resistant crops. The PAT gene is an approved food additive for use as a processing aid in the development of new varieties of crops, including wheat, corn, and rice.
  • Alternative names

    • PAT antibody
    • Phosphinothricin resistance protein antibody
    • PPT N acetyltransferase antibody

Images

  • All lanes : Anti-Phosphinotricin Acetyl Transferase antibody (ab225957) at 1/500 dilution

    Lane 1 : Recombinant protein 60 ng
    Lane 2 : Recombinant protein 30 ng
    Lane 3 : Recombinant protein 15 ng
    Lane 4 : Recombinant protein 7.5 ng

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Observed band size: 36 kDa
    why is the actual band size different from the predicted?



    This antibody has only been tested in WB using the recombinant protein, we have no data for endogenous protein.

References

ab225957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up