Overview

  • Product name

  • Description

    Rabbit polyclonal to Phospho1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Phospho1 aa 1-267.
    Sequence:

    MSGCFPVSGLRCLSRDGRMAAQGAPRFLLTFDFDETIVDENSDDSIVRAA PGQRLPESLRATYREGFYNEYMQRVFKYLGEQGVRPRDLSAIYEAIPLSP GMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHSLFRRILSNPS GPDARGLLALRPFHTHSCARCPANMCKHKVLSDYLRERAHDGVHFERLFY VGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPW ETAADVRLHLQQVLKSC


    Database link: Q8TCT1

  • Positive control

    • IHC-P: Human heart and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab224724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization.
  • Tissue specificity

    Expressed at sites of mineralization in bone and cartilage. Highly expressed in osteoblast cell line SaOS-2 which produces a mineralized matrix, but not in MG-63 cell line, which do not mineralize.
  • Sequence similarities

    Belongs to the HAD-like hydrolase superfamily. PHOSPHO family.
  • Information by UniProt
  • Database links

  • Alternative names

    • PHOP1_HUMAN antibody
    • Phosphatase orphan 1 antibody
    • Phospho 1 antibody
    • phospho1 antibody
    • Phosphoethanolamine/phosphocholine phosphatase antibody
    see all

Images

  • Paraffin-embedded human heart tissue stained for Phospho1 using ab224724 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Phospho1 using ab224724 at 1/100 dilution in immunohistochemical analysis.

References

ab224724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up