Overview

  • Product name

    Anti-Phospholipase A2 XII/PLA2G12A antibody [3H2C11]
    See all Phospholipase A2 XII/PLA2G12A primary antibodies
  • Description

    Mouse monoclonal [3H2C11] to Phospholipase A2 XII/PLA2G12A
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Phospholipase A2 XII/PLA2G12A aa 21-189. (Purified from E.coli).
    Sequence:

    RCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDG SKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKS KNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKP YLDSQRAACRCHYEEKTDL


    Database link: Q9BZM1

  • Positive control

    • Human Phospholipase A2 XII/PLA2G12A (aa21-189) recombinant protein; Phospholipase A2 XII/PLA2G12A (aa21-189)-hIgGFc transfected HEK293 cell lysate; HeLa cells; Human liver cancer tissue.
  • General notes

     This product was previously labelled as Phospholipase A2 XII

     

Properties

Applications

Our Abpromise guarantee covers the use of ab201944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 21 kDa.

Target

  • Function

    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine.
  • Tissue specificity

    Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas.
  • Sequence similarities

    Belongs to the phospholipase A2 family.
  • Cellular localization

    Secreted. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 3.1.1.4 antibody
    • Group XII secreted phospholipase A2 antibody
    • Group XIIA secreted phospholipase A2 antibody
    • Group XIIA secretory phospholipase A2 antibody
    • Group XIIA secretory phospholipase A2 precursor antibody
    • GXII antibody
    • GXII sPLA2 antibody
    • PG12A_HUMAN antibody
    • phosphatidylcholine 2 acylhydrolase 12A antibody
    • Phosphatidylcholine 2 acylhydrolase GXII antibody
    • Phosphatidylcholine 2-acylhydrolase 12A antibody
    • Phospholipase A2 group XIIA antibody
    • PLA2G12 antibody
    • Pla2g12a antibody
    • ROSSY antibody
    • sPLA2 XII antibody
    • sPLA2-XII antibody
    see all

Images

  • Anti-Phospholipase A2 XII/PLA2G12A antibody [3H2C11] (ab201944) at 1/500 dilution + Human Phospholipase A2 XII/PLA2G12A (aa21-189) recombinant protein

    Predicted band size: 21 kDa



    Expected MWt is 44.5 kDa.

  • All lanes : Anti-Phospholipase A2 XII/PLA2G12A antibody [3H2C11] (ab201944) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Phospholipase A2 XII/PLA2G12A (aa21-189)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 21 kDa

  • Flow cytometric analysis of HeLa cells labeling Phospholipase A2 XII/PLA2G12A with ab201944 at 1/200 dilution (green) compared to a negative control (red).

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Phospholipase A2 XII/PLA2G12A with ab201944 at 1/200 dilution, with DAB staining.

References

ab201944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up