Overview

  • Product name

    Anti-Phospholipase C beta 2/PLCB2 antibody - C-terminal
    See all Phospholipase C beta 2/PLCB2 primary antibodies
  • Description

    Rabbit polyclonal to Phospholipase C beta 2/PLCB2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Phospholipase C beta 2/PLCB2 aa 1095-1174.
    Sequence:

    ERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRA CLRTCFPSEAKDKPERACECPPELCEQDPL


    Database link: Q00722

  • Positive control

    • ICC/IF: PC-3 cells.
  • General notes

     This product was previously labelled as Phospholipase C beta 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 134 kDa.

Target

  • Function

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
  • Sequence similarities

    Contains 1 C2 domain.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1-phosphatidylinositol-4 antibody
    • 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2 antibody
    • 5-bisphosphate phosphodiesterase beta-2 antibody
    • FLJ38135 antibody
    • Phosphoinositide phospholipase C-beta-2 antibody
    • Phospholipase C-beta-2 antibody
    • PLC-beta-2 antibody
    • Plcb2 antibody
    • PLCB2_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized PC-3 cells labeling Phospholipase C beta 2/PLCB2 with ab220285 at 4 µg/mL (green).

  • Anti-Phospholipase C beta 2/PLCB2 antibody - C-terminal (ab220285) at 0.4 µg/ml + Human cell line HEL

    Predicted band size: 134 kDa

References

ab220285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up