Overview

  • Product name

    Anti-Phosphoserine Aminotransferase antibody
    See all Phosphoserine Aminotransferase primary antibodies
  • Description

    Rabbit polyclonal to Phosphoserine Aminotransferase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human Phosphoserine Aminotransferase aa 138-340. (BC000971).
    Sequence:

    STWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVD VSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNS SLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQG FYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRS VGG


    Database link: Q9Y617

  • Positive control

    • Human fetal brain lysate; Human fetal kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 40 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.
  • Tissue specificity

    Expressed at high levels in the brain, liver, kidney and pancreas, and very weakly expressed in the thymus, prostate, testis and colon.
  • Pathway

    Amino-acid biosynthesis; L-serine biosynthesis; L-serine from 3-phospho-D-glycerate: step 2/3.
    Cofactor biosynthesis; pyridoxine 5'-phosphate biosynthesis; pyridoxine 5'-phosphate from D-erythrose 4-phosphate: step 3/5.
  • Involvement in disease

    Defects in PSAT1 are the cause of phosphoserine aminotransferase deficiency (PSATD) [MIM:610992]. PSATD is characterized biochemically by low plasma and cerebrospinal fluid concentrations of serine and glycine and clinically by intractable seizures, acquired microcephaly, hypertonia, and psychomotor retardation.
  • Sequence similarities

    Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. SerC subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.6.1.52 antibody
    • Endometrial progesterone induced protein antibody
    • EPIP antibody
    • MGC1460 antibody
    • NLS2 antibody
    • Phosphohydroxythreonine aminotransferase antibody
    • phosphoserine aminotransferase 1 antibody
    • Phosphoserine aminotransferase antibody
    • PSA antibody
    • PSAT antibody
    • Psat1 antibody
    • PSATD antibody
    • SERC_HUMAN antibody
    see all

Images

  • Anti-Phosphoserine Aminotransferase antibody (ab197185) at 1/500 dilution + Human fetal brain lysate

    Predicted band size: 40 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal kidney tissue labeling Phosphoserine Aminotransferase with ab197185 at 1/100 dilution.

References

ab197185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up