Overview

  • Product name

    Anti-Phosphoserine Aminotransferase antibody
    See all Phosphoserine Aminotransferase primary antibodies
  • Description

    Rabbit polyclonal to Phosphoserine Aminotransferase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Phosphoserine Aminotransferase aa 1-312. (Expressed in E.coli).
    Sequence:

    MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFA KIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCAD YVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVY YCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQK NVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYV MGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVSVGGIRASLY NAVTIEDVQKLA


    Database link: Q9Y617

  • Positive control

    • IHC-P: Human cerebrum, glioma and kidney tissues. ICC/IF: HeLa cells. WB: HeLa and HepG2 cell lysates; Pig and mouse brain lysates; Recombinant human Phosphoserine Aminotransferase protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232944 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 40 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.
  • Tissue specificity

    Expressed at high levels in the brain, liver, kidney and pancreas, and very weakly expressed in the thymus, prostate, testis and colon.
  • Pathway

    Amino-acid biosynthesis; L-serine biosynthesis; L-serine from 3-phospho-D-glycerate: step 2/3.
    Cofactor biosynthesis; pyridoxine 5'-phosphate biosynthesis; pyridoxine 5'-phosphate from D-erythrose 4-phosphate: step 3/5.
  • Involvement in disease

    Defects in PSAT1 are the cause of phosphoserine aminotransferase deficiency (PSATD) [MIM:610992]. PSATD is characterized biochemically by low plasma and cerebrospinal fluid concentrations of serine and glycine and clinically by intractable seizures, acquired microcephaly, hypertonia, and psychomotor retardation.
  • Sequence similarities

    Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. SerC subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.6.1.52 antibody
    • Endometrial progesterone induced protein antibody
    • EPIP antibody
    • MGC1460 antibody
    • NLS2 antibody
    • Phosphohydroxythreonine aminotransferase antibody
    • phosphoserine aminotransferase 1 antibody
    • Phosphoserine aminotransferase antibody
    • PSA antibody
    • PSAT antibody
    • Psat1 antibody
    • PSATD antibody
    • SERC_HUMAN antibody
    see all

Images

  • Anti-Phosphoserine Aminotransferase antibody (ab232944) at 2 µg/ml + Recombinant human Phosphoserine Aminotransferase protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 40 kDa

  • Paraffin-embedded human cerebrum tissue stained for Phosphoserine Aminotransferase using ab232944 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Phosphoserine Aminotransferase using ab232944 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Phosphoserine Aminotransferase using ab232944 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Phosphoserine Aminotransferase (green) using ab232944 at 20 µg/ml in ICC/IF, followed by FITC staining.

  • All lanes : Anti-Phosphoserine Aminotransferase antibody (ab232944) at 2 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : Pig brain lysate
    Lane 4 : Mouse brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 40 kDa

References

ab232944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up