Overview

  • Product name

    Anti-Phostensin antibody - C-terminal
  • Description

    Rabbit polyclonal to Phostensin - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse, Cat, Pig
  • Immunogen

    Synthetic peptide within Human Phostensin aa 405-454 (C terminal). The exact sequence is proprietary. NP_597728
    Sequence:

    PEDAGTGGLRQQEEEAVELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFY


    Database link: Q6NYC8

  • Positive control

    • HepG2 cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa.

Target

  • Relevance

    Protein phosphatase-1 (PP1) interacts with regulatory subunits that target the enzyme to different cellular locations and change its activity toward specific substrates. Phostensin is a regulatory subunit that targets PP1 to F-actin cytoskeleton.
  • Cellular localization

    Cytoplasm; cytoskeleton
  • Database links

  • Alternative names

    • HKMT1098 antibody
    • KIAA1949 antibody
    • PPP1R18 antibody
    • Protein phosphatase 1 F actin cytoskeleton targeting subunit antibody
    • Protein phosphatase 1 regulatory subunit 18 antibody
    see all

Images

  • Anti-Phostensin antibody - C-terminal (ab178365) at 1 µg/ml + HepG2 cell line lysate at 10 µg

    Secondary
    Goat anti-rabbit HRP conjugated antibody at 1/15000 dilution

    Developed using the ECL technique.

    Predicted band size: 68 kDa


    Exposure time: 1 minute

References

ab178365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up