Overview

  • Product name

  • Description

    Rabbit polyclonal to PHOX2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PHOX2B aa 268-302.
    Sequence:

    GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN


    Database link: Q99453

  • Positive control

    • ICC/IF: SH-SY5Y (human neuroblastoma cell line from bone marrow) cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Involved in the development of several major noradrenergic neuron populations, including the locus coeruleus. Transcription factor which could determine a neurotransmitter phenotype in vertebrates. Enhances second-messenger-mediated activation of the dopamine beta-hydrolase and c-fos promoters, and of several enhancers including cAMP-response element and serum-response element.
  • Tissue specificity

    Expressed in neuroblastoma, brain and adrenal gland.
  • Involvement in disease

    Defects in PHOX2B are a cause of congenital central hypoventilation syndrome (CCHS) [MIM:209880]; also known as congenital failure of autonomic control or Ondine curse. Most mutations consist of 5-10 alanine expansions in the poly-Ala region from amino acids 241-260. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases.
    Defects in PHOX2B are the cause of susceptibility to neuroblastoma type 2 (NBLST2) [MIM:613013]. A common neoplasm of early childhood arising from embryonic cells that form the primitive neural crest and give rise to the adrenal medulla and the sympathetic nervous system.
  • Sequence similarities

    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NBLST2 antibody
    • NBPhox antibody
    • Neuroblastoma paired type homeobox protein antibody
    • Neuroblastoma Phox antibody
    • Paired like homeobox 2b antibody
    • Paired mesoderm homeobox 2b antibody
    • Paired mesoderm homeobox protein 2B antibody
    • Paired-like homeobox 2B antibody
    • PHOX 2B antibody
    • PHOX 2B homeodomain protein antibody
    • PHOX2B antibody
    • PHOX2B homeodomain protein antibody
    • PHX2B_HUMAN antibody
    • PMX 2B antibody
    • PMX2B antibody
    see all

Images

  • SH-SY5Y cells stained for PHOX2B (green) using ab222036 (4 µg/ml) in immunocytochemistry/ immunofluorescence.

References

ab222036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up