Overview

  • Product name

  • Description

    Rabbit polyclonal to PHPT1
  • Host species

    Rabbit
  • Specificity

    ab196608 detects endogenous level of total PHPT1 protein
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human PHPT1 aa 1-125.
    Sequence:

    AVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAE YHADIYDKVS GDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGP AQHAISTEKIKAKYPDYEVTWA NDGY


    Database link: Q9NRX4

  • Positive control

    • MCF7, A549 and THP-1 cell lysates. HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab196608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 14 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/50 - 1/100.

Target

  • Function

    Exhibits phosphohistidine phosphatase activity.
  • Tissue specificity

    Expressed abundantly in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the janus family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 14 kDa phosphohistidine phosphatase antibody
    • CGI 202 antibody
    • HSPC141 antibody
    • Phosphohistidine phosphatase 1 antibody
    • PHP14 antibody
    • PHP14_HUMAN antibody
    • PHPT1 antibody
    • Protein janus A homolog antibody
    • Protein janus-A homolog antibody
    • Sex regulated protein janus a antibody
    see all

Images

  • Immunofluorescence analysis of HeLa cell labeling PHPT1 using ab196608 at 1/50 dilution. Blue: DAPI for nuclear staining.

  • All lanes : Anti-PHPT1 antibody (ab196608) at 1/500 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : A549 cell lysate
    Lane 3 : THP-1 cell lysate

    Predicted band size: 14 kDa

References

ab196608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up